BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l16f (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0634 + 9986742-9987512 35 0.062 07_03_0573 + 19614899-19617155,19617384-19617476,19618103-19618125 27 9.4 >03_02_0634 + 9986742-9987512 Length = 256 Score = 34.7 bits (76), Expect = 0.062 Identities = 23/73 (31%), Positives = 36/73 (49%) Frame = +2 Query: 416 RILEKTLAVLNPFHGQSKADDANFLLRDTDIAGPIXXXXXXXXXXXXSGNKAHFGFVYGL 595 +I KTL++L+P AD + L D D++GP +G K HFG V G Sbjct: 97 QIWRKTLSILHPLRS---ADPS--LHADADLSGPFLFLLSFGLFQLLAG-KFHFGIVLGW 150 Query: 596 SMMSVILMYFLLS 634 ++ + +YF+ S Sbjct: 151 VTVASLFLYFVFS 163 >07_03_0573 + 19614899-19617155,19617384-19617476,19618103-19618125 Length = 790 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 60 NRITHKRN*LRQDCFTASSWLTITIPMNMHGKRKA 164 +R++H R LR+ SS T T + HG+R+A Sbjct: 15 SRLSHSRPLLRRAGSACSSLTTTTTSQHRHGRRRA 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,054,583 Number of Sequences: 37544 Number of extensions: 304103 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -