BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l11r (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 26 0.33 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.8 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.8 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 24 1.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.8 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.4 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.4 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 26.2 bits (55), Expect = 0.33 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -3 Query: 212 SVQHRSGDNRK*LPRIYS*NGYCQTCKAWVWNVPSKYRHEVPIPFVMP 69 S+ +R+ N Y+ N Y CK +N+ Y ++P+P +P Sbjct: 84 SLSNRTIHNNNNYKYNYNNNNYNNNCKKLYYNI--NYIEQIPVPVPVP 129 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 164 YS*NGYCQTCKAWVWNVPSKYRHEVPIP 81 Y+ N Y CK +N+ Y ++PIP Sbjct: 100 YNNNNYNNNCKKLYYNI--NYIEQIPIP 125 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 164 YS*NGYCQTCKAWVWNVPSKYRHEVPIP 81 Y+ N Y CK +N+ Y ++PIP Sbjct: 100 YNNNNYNNNCKKLYYNI--NYIEQIPIP 125 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 164 YS*NGYCQTCKAWVWNVPSKYRHEVPIP 81 Y+ N Y CK +N+ Y ++PIP Sbjct: 100 YNNNNYNNNCKKLYYNI--NYIEQIPIP 125 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 445 DWENNVLRLGTNDAQYVEVIH 383 DW N+ + G N + +E+IH Sbjct: 232 DWLFNLTKYGKNQIKLLEIIH 252 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 694 LTSGDYNVIVVDWSSF 647 + +GDY V+ +WSSF Sbjct: 379 IQNGDYVVLETEWSSF 394 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 694 LTSGDYNVIVVDWSSF 647 + +GDY V+ +WSSF Sbjct: 85 IQNGDYVVLETEWSSF 100 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 247 AATITHGKHYGNQCSTEAEITANN 176 A+ + K+Y CSTE +T N Sbjct: 441 ASVTPYNKNYTKFCSTEKRLTKQN 464 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 52 FVLSFVGITNGMGTSCRY 105 F+LS VG+ G+G R+ Sbjct: 28 FILSVVGLAIGLGNLWRF 45 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 52 FVLSFVGITNGMGTSCRY 105 F+LS VG+ G+G R+ Sbjct: 81 FILSVVGLAIGLGNLWRF 98 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 100 RYLLGTFQTHALQVWQYPFQL*ILGNYLRLSP 195 R++ + HA ++QY F + I R+SP Sbjct: 350 RHVQAEAEKHAAMLYQYNFNIIISEPTERISP 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,981 Number of Sequences: 438 Number of extensions: 5054 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -