BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l09r (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical pr... 29 2.7 AC024759-4|AAK68434.1| 356|Caenorhabditis elegans Hypothetical ... 29 2.7 >Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical protein F42E11.3 protein. Length = 258 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 268 KFALFFCRMVVLDTLPLFWAVASRYLNFQI 357 KF + C +V +PL+W V S +L QI Sbjct: 99 KFVISICDRLVTAQMPLYWFVVSAFLIIQI 128 >AC024759-4|AAK68434.1| 356|Caenorhabditis elegans Hypothetical protein Y37E11AR.4 protein. Length = 356 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 753 DHDHHDSGLNXTWLGHCCSILLHHGVQYL 667 D H +SGL TWLGH ++ GV+++ Sbjct: 76 DDFHSESGLFATWLGHATVLVDLEGVKFV 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,999,378 Number of Sequences: 27780 Number of extensions: 323736 Number of successful extensions: 687 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -