Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV10l08r
         (706 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O97292 Cluster: Putative uncharacterized protein MAL3P7...    34   3.9  

>UniRef50_O97292 Cluster: Putative uncharacterized protein
           MAL3P7.22; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein MAL3P7.22 - Plasmodium
           falciparum (isolate 3D7)
          Length = 2706

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = +3

Query: 96  KGNANSNSHYSTXAYREKKLLFTQLNPKQ----HXDXTILSPNRISIYKYFQNESEQIF 260
           K N N+N H      R+KKL F  L  K+    H +   ++P+ + I KY    S++I+
Sbjct: 727 KYNENNNDHNINGNGRKKKLKFLLLTTKKIYDDHDEHMSITPHDVEITKYVNKVSDEIY 785


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 509,447,816
Number of Sequences: 1657284
Number of extensions: 7996215
Number of successful extensions: 13183
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12927
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13180
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 56198352344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)