BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l08r (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0793 + 24662506-24663512,24664470-24664787,24664996-246653... 28 8.3 >06_03_0793 + 24662506-24663512,24664470-24664787,24664996-24665323, 24665465-24665887,24665960-24666252,24666332-24666605, 24666856-24667358,24667464-24667785,24667875-24668220, 24668339-24668997,24669524-24669625,24669656-24670052, 24670155-24670270,24670360-24670386 Length = 1704 Score = 27.9 bits (59), Expect = 8.3 Identities = 22/54 (40%), Positives = 29/54 (53%) Frame = -3 Query: 224 NANSVRT*DCRIXVLFWV*LSEQQFFFSIGPCTIVAVAIRVSFALRKIKMSILE 63 N N +R RI W LSE FF S+G ++VAI V +LR++ M LE Sbjct: 1052 NVNRIRLVWSRI----WKVLSE--FFVSVGLLENLSVAIFVMDSLRQLAMKFLE 1099 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,797,561 Number of Sequences: 37544 Number of extensions: 190438 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 246 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -