BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l08r (706 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens ... 32 1.7 AK125796-1|BAC86296.1| 617|Homo sapiens protein ( Homo sapiens ... 30 7.0 >AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ46153 fis, clone TESTI4001037. ). Length = 130 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 335 FFNLTLFVYSFIX*FRFSXFIVSLPHYVLTLAPIFXNLIQYVXVGFKCPQI 487 F L+ F + F+ F FS F+ SLP ++ + P F ++ F C I Sbjct: 24 FLFLSFFFFLFLS-FSFSFFLFSLPSFLPSFLPSFLPSFPFLFFSFYCDMI 73 >AK125796-1|BAC86296.1| 617|Homo sapiens protein ( Homo sapiens cDNA FLJ43808 fis, clone TESTI4001148, weakly similar to Dynein beta chain, ciliary. ). Length = 617 Score = 30.3 bits (65), Expect = 7.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 398 VSLPHYVLTLAPIFXNLIQYVXVGFKCPQIR 490 ++LP +VL P+F LI + G CP++R Sbjct: 522 MNLPKFVLEDVPLFLGLISDLFPGLDCPRVR 552 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,482,726 Number of Sequences: 237096 Number of extensions: 1129736 Number of successful extensions: 1550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -