BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l08f (553 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.44 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 1.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 2.3 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 5.4 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 25.0 bits (52), Expect = 0.44 Identities = 23/75 (30%), Positives = 28/75 (37%) Frame = -2 Query: 549 DVEDCF*QLNVSRREETGCHRGVDVSSRHVTDALHNRSNEQAKAQRNAGGVGRCAGVDGD 370 DVE LNV RG D + ++ RS A A N G AG GD Sbjct: 233 DVEGSQKLLNVDASIRGWIERGADPGKLVLGLGVYGRSFTLASASNNKLGAPIVAG--GD 290 Query: 369 AGGHANRSKEEGANQ 325 AG + G N+ Sbjct: 291 AGRYTGERGMMGYNE 305 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 468 RHVTDALHNRSNEQAKAQRN 409 RH+ DALH ++ ++ Q+N Sbjct: 65 RHLPDALHTECSKCSETQKN 84 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 2.3 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = -3 Query: 380 LMVMQAATPIEVRRKVPTSSATSCLQISLLSVTSDSP 270 ++ + TP+ + TSS+ S ++ DSP Sbjct: 150 ILTKTSPTPVSINNNTSTSSSASSPSVTAAPHLRDSP 186 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.4 bits (43), Expect = 5.4 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +3 Query: 15 CVPRRPHAPQ 44 CV +RPH+P+ Sbjct: 18 CVRKRPHSPE 27 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,487 Number of Sequences: 336 Number of extensions: 1879 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -