BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l02r (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 1.8 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 23 1.8 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 23 1.8 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.7 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 1.8 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 449 IWLNRKRLLVVTLRTTKP*PSFVNKLHSLTESTTLG 342 I+L R V R KP F L LTE TLG Sbjct: 483 IYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLG 518 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 549 PARTPYHWDNSTS 511 PAR+PY W TS Sbjct: 119 PARSPYEWIKKTS 131 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 549 PARTPYHWDNSTS 511 PAR+PY W TS Sbjct: 119 PARSPYEWIKKTS 131 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -1 Query: 696 HQHAASWVAVTYQGEEIGMRDGYVSWEDTVDIEACNRGDPDTYHLYSRDPARTPY 532 H H + VA + + Y S+ ++ + +HL +R P +PY Sbjct: 14 HHHQSGSVAGHHHEQSAAAAAAYRSFPLSLGMSPYASSQHHHHHLQARPPQDSPY 68 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -1 Query: 477 PVAEDYQEINLAKQKETARSHFKNYQALTKLRKQATLSH 361 PV QE+ +K T + H KN K+R L + Sbjct: 489 PVKISVQEVLNRVRKPTKKLHLKNSPISKKVRPPQVLCY 527 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 603 IEACNRGDPDTY 568 +E C+RGD TY Sbjct: 532 VEYCSRGDLQTY 543 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,190 Number of Sequences: 336 Number of extensions: 3188 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -