BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10l02f (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 2.2 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 2.2 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 2.2 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 22 3.9 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 22 3.9 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 3.9 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.0 bits (47), Expect = 2.2 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = +1 Query: 154 LDWWKNCVLYQIYP 195 + W++ CV Y ++P Sbjct: 198 ITWYQQCVTYNVFP 211 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.0 bits (47), Expect = 2.2 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = +1 Query: 154 LDWWKNCVLYQIYP 195 + W++ CV Y ++P Sbjct: 198 ITWYQQCVTYNVFP 211 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 663 LDSKLV*IVLLTFLTPFPGRTSELTDPIRRRKPD-SRIFRVW 541 +D ++ IVLLTF + +L + +RR + D R++ W Sbjct: 281 VDKEIAYIVLLTFASDLLFILIQLFNSLRRMRNDLERLYFYW 322 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 22.2 bits (45), Expect = 3.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 539 FQTLKILESGFLLLIGSVSSEVRPGNGVRNVSSTIYT 649 F TLKIL + L + E RP ++ + + IY+ Sbjct: 151 FATLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYS 187 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 22.2 bits (45), Expect = 3.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 539 FQTLKILESGFLLLIGSVSSEVRPGNGVRNVSSTIYT 649 F TLKIL + L + E RP ++ + + IY+ Sbjct: 151 FATLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYS 187 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 22.2 bits (45), Expect = 3.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 539 FQTLKILESGFLLLIGSVSSEVRPGNGVRNVSSTIYT 649 F TLKIL + L + E RP ++ + + IY+ Sbjct: 471 FATLKILLGKYTQLKACLMEEKRPMVSLQVIKAQIYS 507 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,869 Number of Sequences: 336 Number of extensions: 3489 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -