BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k21r (759 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 64 1e-12 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 4.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 4.1 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 64.1 bits (149), Expect = 1e-12 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = -2 Query: 680 QGGDFGHMIGSHIATIFPSEVLGFHTNFPANXXXXXXXXXXXXXXXWPSYFG-NGIEDRM 504 QGGD+G +I S +A +FP +++G H N +PS G N + Sbjct: 1 QGGDWGSVIASDMAVLFPEKIIGLHNNM-CTSLNLSNLFWLFVGTYFPSLIGANEHYSKF 59 Query: 503 YPLKDKLEFYLEETGYSHLQSTKPDT 426 +P+ + L F +EE+GY H+Q+TKPDT Sbjct: 60 FPVSEILSFLIEESGYFHIQATKPDT 85 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 696 HPILHSRRRFRAHDRIPYRHDL 631 HPI H RR+ R+ D +R + Sbjct: 82 HPIRHGRRQSRSMDLNAHREQM 103 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 251 LYSRRPNITLCCPVTCQ----NRNTCQCRL 328 LYS R ++TL CP+ + +R C R+ Sbjct: 149 LYSIRISLTLSCPMNLKLYPLDRQVCSLRM 178 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 251 LYSRRPNITLCCPVTCQ----NRNTCQCRL 328 LYS R ++TL CP+ + +R C R+ Sbjct: 149 LYSIRISLTLSCPMNLKLYPLDRQVCSLRM 178 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,011 Number of Sequences: 438 Number of extensions: 5657 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -