BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k21f (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 5.2 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 6.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI++L++LS+ I + W P Sbjct: 465 WIWLLWLLSQTWITLHIWTP 484 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI++L++LS+ I + W P Sbjct: 465 WIWLLWLLSQTWITLHIWTP 484 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI++L++LS+ I + W P Sbjct: 465 WIWLLWLLSQTWITLHIWTP 484 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI++L++LS+ I + W P Sbjct: 465 WIWLLWLLSQTWITLHIWTP 484 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 5.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -3 Query: 419 EALYLPLHETVVFKKRP 369 + L+ P+H+TV++ P Sbjct: 40 DKLHHPIHQTVIYHNNP 56 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 192 VVKALFTIYGIYLVYVSLTNVPDLPKVDVNLR 287 + K F ++G L YVS L ++D L+ Sbjct: 2 IFKIHFLVFGALLTYVSSVEYLILREIDTILK 33 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI+++++LS+ I + W P Sbjct: 219 WIWLVWLLSQAWISVHIWSP 238 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI+++++LS+ I + W P Sbjct: 452 WIWLVWLLSQAWISVHIWSP 471 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 559 WIYILFVLSRKLIKMLRWYP 618 WI+++++LS+ I + W P Sbjct: 452 WIWLVWLLSQAWISVHIWSP 471 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 298 STPHRRLTSTLGKSGTFVSD 239 STP + LTS + + FV D Sbjct: 603 STPFKELTSNVFRMNQFVYD 622 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,302 Number of Sequences: 336 Number of extensions: 2890 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -