BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k21f (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|... 28 1.4 SPAC823.14 |||phosphoric monoester hydrolase |Schizosaccharomyce... 27 2.4 SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi... 27 3.2 SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pomb... 25 7.4 SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe... 25 9.7 SPBC543.10 |||GET complex subunit |Schizosaccharomyces pombe|chr... 25 9.7 SPCC613.03 |||conserved fungal protein|Schizosaccharomyces pombe... 25 9.7 >SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 444 VHSDAFAQFFSHWIFKYKFRERVKFLNKYDHFLTNIQG 557 V + +FF H + +E VK LN +F+TN G Sbjct: 457 VFQKPYVEFFVHPSLLNELKETVKKLNSVSYFVTNKNG 494 >SPAC823.14 |||phosphoric monoester hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 229 Score = 27.1 bits (57), Expect = 2.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 336 VIFSDAMESEIRALFEDYRLMERKIKSFKNTAWTYGVHSD 455 +I S ME IRALFE Y L + + S + + VH D Sbjct: 98 IILSSGMEPFIRALFEQY-LGKEEASSIEIVSNDINVHPD 136 >SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 26.6 bits (56), Expect = 3.2 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 150 LVFGVFSKIISYLFVVKALFTIYGIYLVYVSLT 248 L+F V+ IIS V + T YG YLV SLT Sbjct: 13 LLFFVYLLIISTRLVAADMNTQYGCYLVDSSLT 45 >SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +3 Query: 219 GIYLVYVSLTNVPDLPKVDVNLRWGVDNNTHDTRIRPYRVIFSDAMESEIRALFEDY 389 G+ + +V NV +P+ +L NN+ PYR+ D E E+ + Y Sbjct: 235 GLDIKFVDYGNVYGVPEHTSSLSLKETNNSDAGYTEPYRLYNVDLFEYEVDSPMSQY 291 >SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 537 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 174 IISYLFVVKALFTIYGIYLVYVSLTNVPDLPKVDVN 281 ++ + F++ ALF +G YLV + + PD+ VN Sbjct: 71 LMIFFFIIPALFGAFGNYLVPL-MIGAPDVAYPRVN 105 >SPBC543.10 |||GET complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 171 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 210 TIYGIYLVYVSLTNVPDLPK 269 TI G Y +YVS++N DL K Sbjct: 26 TIDGAYRIYVSVSNNKDLKK 45 >SPCC613.03 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 189 Score = 25.0 bits (52), Expect = 9.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 368 DFRFHRVTKYHPVG 327 +F H V KYHP G Sbjct: 124 EFEMHHVEKYHPAG 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,439,251 Number of Sequences: 5004 Number of extensions: 48018 Number of successful extensions: 154 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -