BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k21f (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.9 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 376 SALISDSIASLNITL*GLILVSCVLLSTPH 287 +A++ D + + TL +I VLLS PH Sbjct: 522 AAMVIDRMCLIIFTLFTIIATIAVLLSAPH 551 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 544 LIFRVWIYILFVLSRKLIKMLRWYPFYFCTAGQVLLEN 657 L V+ IL L RK+ +M P++ T +L N Sbjct: 323 LALSVFALILTALLRKMQEMSIEVPYWISTTTSFVLNN 360 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,893 Number of Sequences: 438 Number of extensions: 3299 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -