BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k16r (414 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 25 1.4 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 1.4 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 25 1.4 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 1.4 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 4.4 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 4.4 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 5.8 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 22 7.7 AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 22 7.7 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 22 7.7 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 22 7.7 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 24.6 bits (51), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 84 VEGLGKSDSGSRDDRGTNNYGLDDFG 161 + G G+S + S + GT+ GL DFG Sbjct: 35 INGTGQSFNFSGESNGTSIPGLPDFG 60 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.6 bits (51), Expect = 1.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -1 Query: 180 APQPCPPRSRQARNCWYPYHPGSRCHSSRDPQ 85 A P PP ++ C H S C S+ D Q Sbjct: 497 AAPPTPPERQRCFRCLEMGHIASNCRSTADRQ 528 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 24.6 bits (51), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 84 VEGLGKSDSGSRDDRGTNNYGLDDFG 161 + G G+S + S + GT+ GL DFG Sbjct: 35 INGTGQSFNFSGESNGTSIPGLPDFG 60 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 24.6 bits (51), Expect = 1.4 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -1 Query: 159 RSRQARNCWYPYHPGSRCHSSRDPQLSQLTDILA 58 +++ RNC P H G C +R + + + + A Sbjct: 25 QAQTCRNCAAPVHHGLNCVQNRQNRFANVVQVKA 58 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 4.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 263 DIAEEPLPEVVILPTPVFPEI 201 D+ E P I+P P FP+I Sbjct: 546 DMKEAPTTNPRIVPIPTFPQI 566 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.0 bits (47), Expect = 4.4 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = -2 Query: 413 VDTYEPISVGPAIVEGAPVTVTGADGTPLVQIIIN 309 ++ + + +EG +TV DG P+ + +N Sbjct: 391 INAFASVCPAQVTIEGHALTVIATDGEPVHPVQVN 425 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 22.6 bits (46), Expect = 5.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 191 QERRFQEIREWGE*QLRAKALRQCPQHQRDQRQSRK 298 Q+++ Q+ + QLR + +Q PQ Q+ QR ++ Sbjct: 441 QQQQQQQGERYVPPQLRQQRQQQQPQQQQQQRPQQQ 476 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 22.2 bits (45), Expect = 7.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 2 IFHLDHHFCIFIYNY 46 +FH +H F IY+Y Sbjct: 418 MFHCNHPFVFLIYDY 432 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 22.2 bits (45), Expect = 7.7 Identities = 16/72 (22%), Positives = 25/72 (34%) Frame = +3 Query: 81 SVEGLGKSDSGSRDDRGTNNYGLDDFGEDRAGELHGFRNVDFRKYGSGENNNFGQRLFGN 260 +V G G + +G G FG+ ++G F N +G + G G Sbjct: 56 NVPGFGNGQQPGQQQQGQQGQGFPFFGQGQSG-FPSFGNRLQPFFGQNQQGQDGDAQQGR 114 Query: 261 VLNINGISGNLG 296 + G G G Sbjct: 115 GVPFFGQGGGQG 126 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 22.2 bits (45), Expect = 7.7 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 334 VPSAPVTVTGAPSTMAG-PTEMGS 402 +PS P+TV+G+ + G PT S Sbjct: 158 IPSPPITVSGSDMSSPGAPTGSSS 181 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 22.2 bits (45), Expect = 7.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 GGQGWGAPRVQERRFQEIREWGE 229 GG+GW E F+E+ +G+ Sbjct: 217 GGRGWKTESFNEDFFKELLAFGD 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 337,295 Number of Sequences: 2352 Number of extensions: 7017 Number of successful extensions: 21 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -