BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k13r (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 1.1 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 7.8 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.8 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 7.8 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 7.8 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 26.2 bits (55), Expect = 1.1 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -2 Query: 371 ERNVPTMMSTAH-AWQTILHGVQVLVSYMLMLVFMTYNTWLCAAVVLGSATGYFLF 207 +R++P + H AWQ + +VL + VF Y CA L AT F + Sbjct: 288 KRHIPWSGTIVHIAWQFSVTVARVLAIATVASVFPLYTAAACAVHALLMATWVFCY 343 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 611 CSHRETSWTCPYCGYCDHHGLK 676 C++ T P C C +HGLK Sbjct: 29 CNNSLNPRTPPNCARCRNHGLK 50 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 611 CSHRETSWTCPYCGYCDHHGLK 676 C++ T P C C +HGLK Sbjct: 29 CNNSLNPRTPPNCARCRNHGLK 50 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 611 CSHRETSWTCPYCGYCDHHGLK 676 C++ T P C C +HGLK Sbjct: 29 CNNSLNPRTPPNCARCRNHGLK 50 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 611 CSHRETSWTCPYCGYCDHHGLK 676 C++ T P C C +HGLK Sbjct: 29 CNNSLNPRTPPNCARCRNHGLK 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 867,919 Number of Sequences: 2352 Number of extensions: 18073 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -