BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k12r (575 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe... 29 0.64 SPAC11E3.15 |rpl22|SPAP8A3.01|60S ribosomal protein L22|Schizosa... 27 1.5 SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces p... 27 2.0 SPBC19G7.04 |||HMG box protein |Schizosaccharomyces pombe|chr 2|... 26 4.5 >SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1465 Score = 28.7 bits (61), Expect = 0.64 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 34 HYIRNVIFNIFFTELYLANHCKTHRYFTTNSQNIL 138 H R++I N+F E +L HC TTNS N+L Sbjct: 737 HVSRDLIKNLFGPEGFLRTHCVV---LTTNSLNVL 768 >SPAC11E3.15 |rpl22|SPAP8A3.01|60S ribosomal protein L22|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 27.5 bits (58), Expect = 1.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 123 VCRKVSMSLAVICQIQFSKKYIKY 52 V R+ S +AVI I FS +Y+KY Sbjct: 53 VSREGSSKIAVIAHIDFSGRYLKY 76 >SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 27.1 bits (57), Expect = 2.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 467 RRSCDILD*TLSAFERRYRAVGISAVNN 384 RRS D+ D +AF RY A G NN Sbjct: 176 RRSTDLRDRFRNAFPERYAAAGFKLKNN 203 >SPBC19G7.04 |||HMG box protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 362 Score = 25.8 bits (54), Expect = 4.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 89 ITARLIDTLRQTHKIYYLQCNRMIKFDDKIV 181 I+ R TLR +H Y CNR +DK V Sbjct: 63 ISQRNFKTLRASHLSQYRDCNRENNTEDKNV 93 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,997,102 Number of Sequences: 5004 Number of extensions: 37796 Number of successful extensions: 122 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -