BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k12f (613 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 32 0.26 At5g14620.1 68418.m01714 cytosine methyltransferase (DRM2) ident... 31 0.60 At4g12350.1 68417.m01953 transcription factor, putative (MYB42) ... 31 0.60 At2g33080.1 68415.m04056 leucine-rich repeat family protein cont... 31 0.60 At5g27060.1 68418.m03229 disease resistance family protein conta... 29 1.8 At1g63350.1 68414.m07161 disease resistance protein (CC-NBS-LRR ... 29 2.4 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 29 3.2 At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR ... 29 3.2 At2g30800.1 68415.m03755 DEIH-box RNA/DNA helicase, putative sim... 28 5.6 At2g12400.1 68415.m01339 expressed protein 27 7.4 At1g69910.1 68414.m08045 protein kinase family protein contains ... 27 7.4 At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR... 27 9.8 At1g58350.1 68414.m06637 expressed protein contains Pfam profile... 27 9.8 At1g09980.1 68414.m01126 expressed protein contains Pfam profile... 27 9.8 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 32.3 bits (70), Expect = 0.26 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = +2 Query: 410 VQDNKLTKTT--LAKYGNLLDTIIWTNSN-INYLEIDLFKTFPRLSYIDLSGNVIKK 571 + +N++T+ L ++ L +++ TN+ +N +EID + P+L Y+ L N I K Sbjct: 71 INNNRITRINPNLGEFLPKLHSLVLTNNRLVNLVEIDPLASIPKLQYLSLLDNNITK 127 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 410 VQDNKLTKTTLAKYGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGN 559 + DN++ K Y N L T++ N+ I + +L + P+L + L+ N Sbjct: 49 LSDNEIVKLENFPYLNRLGTLLINNNRITRINPNLGEFLPKLHSLVLTNN 98 >At5g14620.1 68418.m01714 cytosine methyltransferase (DRM2) identical to cytosine methyltransferase GI:7658293 from [Arabidopsis thaliana] Length = 626 Score = 31.1 bits (67), Expect = 0.60 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +2 Query: 470 IIWTNSNINYLEIDLFKTFPRLSYID-LSGNVIKKTGTACSRSSV 601 +IW N + ++LEID F++ PR S I + V G A + SS+ Sbjct: 2 VIWNNDDDDFLEIDNFQSSPRSSPIHAMQCRVENLAGVAVTTSSL 46 >At4g12350.1 68417.m01953 transcription factor, putative (MYB42) identical to cDNA putative transcription factor (MYB42) GI:5823330 Length = 168 Score = 31.1 bits (67), Expect = 0.60 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 365 TCTCDDEHLTCSNTSVQDNKLTKTTLAKYGNLLDTIIWTN 484 T T DD +T N+S D +L + YG+L + I+WTN Sbjct: 46 TNTIDDSIITHQNSSNDDYELLGDIIHNYGDLFN-ILWTN 84 >At2g33080.1 68415.m04056 leucine-rich repeat family protein contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 740 Score = 31.1 bits (67), Expect = 0.60 Identities = 14/27 (51%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +2 Query: 488 NINY-LEIDLFKTFPRLSYIDLSGNVI 565 NI+Y L+++LF + L+Y+DLSGN I Sbjct: 253 NISYPLDLNLFSSLKSLTYLDLSGNSI 279 >At5g27060.1 68418.m03229 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 957 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +2 Query: 407 SVQDNKLTKT---TLAKYGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGNVIKKT 574 S+ +NK T T + NL+D N+ LF T P L+YI L+GN +K T Sbjct: 319 SLSNNKFTGTLPPNITSLSNLMDFDASDNAFTGTFPSFLF-TIPSLTYIRLNGNQLKGT 376 >At1g63350.1 68414.m07161 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 898 Score = 29.1 bits (62), Expect = 2.4 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 461 LDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGN 559 L T++ ++++ + + F + P+L+ +DLSGN Sbjct: 539 LTTLLLQSTHLEKISSEFFNSMPKLAVLDLSGN 571 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 28.7 bits (61), Expect = 3.2 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = +2 Query: 386 HLTCSNTSVQDNKLTKTTLAKYGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGNVI 565 HL S++ + L + +KY NL+ + N+ L DLF + +L +DLS N I Sbjct: 131 HLELSSSGLIGT-LPENFFSKYSNLISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNNI 189 >At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 851 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +2 Query: 407 SVQDNKLTKTTLAKYGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGN 559 S+ N++ + + L T++ N+ + ++ D F+ P L +DLS N Sbjct: 519 SLMCNQIANISSSSNSPNLSTLLLQNNKLVHISCDFFRFMPALVVLDLSRN 569 >At2g30800.1 68415.m03755 DEIH-box RNA/DNA helicase, putative similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1299 Score = 27.9 bits (59), Expect = 5.6 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 380 DEHLTCSNTSVQDNKLTKTTLAKYGNLLDTII--WTNSNINYLEIDL 514 D HL+ +N S+ D+KL T K L + II WTN + L +DL Sbjct: 389 DNHLSSTNLSISDHKLDLTDEDKLA-LDEAIILAWTNDEFDAL-LDL 433 >At2g12400.1 68415.m01339 expressed protein Length = 541 Score = 27.5 bits (58), Expect = 7.4 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 359 PDTCTCDDEHLTCSNTSVQDNKLTKTTLAKYG--NLLDTIIWTNSNINY 499 P T D+ L C + + LT+T L Y NLLD I +N N+ Sbjct: 325 PTAHTALDDILPCVDNATARETLTRTKLVTYQLVNLLDNAISNMTNRNF 373 >At1g69910.1 68414.m08045 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.5 bits (58), Expect = 7.4 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 461 LDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGNVIKKTGTACSRSSV 601 L I TN N N F + P +IDL+G+ + + ++CSR S+ Sbjct: 90 LSPITNTNRNTNNCSSLRFSSSPN-RFIDLTGSPFRVSDSSCSRLSL 135 >At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1017 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 455 NLLDTIIWTNSNINYLEIDLFKTFPRLSYIDLSGNVIKK 571 +LL+ + N+ L D FP+L+Y+DLS + KK Sbjct: 884 SLLELCLDNCKNVKSLS-DQLSHFPKLAYLDLSSHDFKK 921 >At1g58350.1 68414.m06637 expressed protein contains Pfam profile PF05057: Protein of unknown function (DUF676); supporting cDNA gi|6520166|dbj|AB028199.1| Length = 794 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 449 YGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDL 550 YG L++ I ++I +LE D+F F S+ DL Sbjct: 759 YGRNLNSFIGRAAHIEFLESDIFARFIMWSFQDL 792 >At1g09980.1 68414.m01126 expressed protein contains Pfam profile PF05057: Protein of unknown function (DUF676); non-consensus GC donor splice site at exon boundary 144764 Length = 802 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 434 TTLAKYGNLLDTIIWTNSNINYLEIDLFKTFPRLSYIDL 550 TTL YG L++ I ++I +LE D+F F S+ DL Sbjct: 764 TTL--YGRNLNSFIGRAAHIEFLESDVFARFIMWSFQDL 800 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,432,507 Number of Sequences: 28952 Number of extensions: 202576 Number of successful extensions: 615 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -