BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k10r (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 9.2 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 9.2 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/51 (23%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 529 IFVLALLA-MANAQDPVKVVENADSVR-DAKKRYGVNVVDNNNPGHVNVVD 383 IF+ L++ ++A D ++ + R D+ K + ++ N N G + ++D Sbjct: 36 IFLRELISNSSDALDKIRYESLTNPSRLDSGKELYIKIIPNKNDGTLTIID 86 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 195 PKITTLMETATNLSTTVHITWTLPKADLTSSLPLS 91 P++TT ++T + + +H WT + SS S Sbjct: 1015 PQVTTGVDTGASSTEHMHPDWTTKPSTWWSSTTTS 1049 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 214 PYIVNPPKDYNPNGNGYE 161 P+IV P++ NP+ Y+ Sbjct: 192 PFIVRVPEEDNPHAKLYD 209 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 470 FHYLNWVLSVGHSQQSEDENLKKIRFIYTM 559 FH + +V +S D+N+KKI + + Sbjct: 597 FHLHGYAFNVVGIGRSPDQNVKKINLKHAL 626 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,728 Number of Sequences: 336 Number of extensions: 3541 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -