BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k10r (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0471 + 34169562-34169892,34170121-34170347 37 0.017 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 34 0.090 04_04_0924 - 29449285-29449290,29449386-29449575,29449669-294497... 34 0.12 10_08_0681 + 19855134-19855454 33 0.16 02_04_0382 - 22501041-22501279,22501717-22501810 30 1.5 06_03_0874 - 25580417-25580419,25580504-25580604,25580828-255814... 30 1.9 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 2.6 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 36.7 bits (81), Expect = 0.017 Identities = 31/98 (31%), Positives = 36/98 (36%), Gaps = 8/98 (8%) Frame = -3 Query: 355 SNPDPGFSRPV-IGQPGYVPISTG----PAYVXXXXXXXXXXXNGYEPIDNRPYIVNPPK 191 SN D GF G PG P+ G P Y P P PP Sbjct: 11 SNADKGFHGAYPSGYPGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPS 70 Query: 190 DYNPNGNGYEPIDNGAYYVDPPQG---RPYFKPTPFPG 86 Y P+ GY P GAY PP G +P + P +PG Sbjct: 71 GYPPSQGGYPP---GAY---PPSGYPQQPGYPPAGYPG 102 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 34.3 bits (75), Expect = 0.090 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = -3 Query: 235 YEPIDNRPYIVNPPKDYNPNGNGYEPI---DNGAYYVDPPQGRPYFKPTPFPGARG 77 Y P + P V PP Y P +G P N + Y +PP GRP P P GA G Sbjct: 394 YAPPQSYPPNVRPPSPYMPPPSGPAPPFYGQNQSMY-EPPVGRPNSGPPPSYGAGG 448 >04_04_0924 - 29449285-29449290,29449386-29449575,29449669-29449772, 29449845-29449976,29450064-29450162,29450439-29450451, 29450688-29450719,29450802-29450921,29450992-29451105, 29451192-29451325,29454014-29454251 Length = 393 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 517 ALLAMANAQDPVKVVENADSVRDAKKRYGVNV-VDNNNPGHVNVVDNNHPGHVLISNPD 344 AL+ + A+ V V + D V +KR VN+ ++N+ ++ +NH G V +SN D Sbjct: 60 ALVVLKEARAAVAVERDEDEVMGHRKRSKVNISSESNSDNDCSLSSDNHDGDVHLSNHD 118 >10_08_0681 + 19855134-19855454 Length = 106 Score = 33.5 bits (73), Expect = 0.16 Identities = 23/80 (28%), Positives = 38/80 (47%) Frame = -3 Query: 577 IPFLINHCVDKPDFL*IFVLALLAMANAQDPVKVVENADSVRDAKKRYGVNVVDNNNPGH 398 + L+ V+K + + + A LA A + + VVE +++ R G + NP H Sbjct: 25 VALLLVGSVEKEEEVVVVRGARLAAARPCEEIYVVEEGETLHSISDRCGDPYILEQNP-H 83 Query: 397 VNVVDNNHPGHVLISNPDPG 338 V+ D+ PG V+ P PG Sbjct: 84 VHDPDDVFPGLVIKITPRPG 103 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 190 DYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFPGARGG 74 D P+ + Y+P + YY DPP Y+ P P P GG Sbjct: 55 DPPPSPDYYDPPHSPDYY-DPPPSPDYYDPPPSPYYGGG 92 >06_03_0874 - 25580417-25580419,25580504-25580604,25580828-25581411, 25581523-25581594,25581667-25581793,25583412-25583516, 25583643-25583676 Length = 341 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -3 Query: 217 RPYIVNP---PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKP 101 +PY P P P G Y P G Y PP+G+P + P Sbjct: 266 QPYPPKPQGQPYPPQPQGQPYPPQPYGQTYPPPPKGQPTYPP 307 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = -3 Query: 229 PIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 89 P + P IV P Y P+ YEP Y +PP PY P FP Sbjct: 636 PYPSPPDIVPSPPSYEPSPPSYEP-SPPEYAPEPPVYAPY-PPGIFP 680 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,396,319 Number of Sequences: 37544 Number of extensions: 395656 Number of successful extensions: 992 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -