BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k10r (675 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 3.8 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 3.8 At5g44780.1 68418.m05488 expressed protein low similarity to SP|... 28 5.0 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 28 5.0 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 6.6 At5g44400.1 68418.m05436 FAD-binding domain-containing protein s... 27 8.7 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 27 8.7 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 27 8.7 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/87 (25%), Positives = 29/87 (33%) Frame = -3 Query: 349 PDPGFSRPVIGQPGYVPISTGPAYVXXXXXXXXXXXNGYEPIDNRPYIVNPPKDYNPNGN 170 P P ++ PV P+ T P P+ +P I PP Y P Sbjct: 67 PPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPPVYTKPTI--PPPVYTPPVY 124 Query: 169 GYEPIDNGAYYVDPPQGRPYFKPTPFP 89 P+ P P +KPTP P Sbjct: 125 KPTPVYTKPTIPPPVYTPPVYKPTPSP 151 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -3 Query: 214 PYIVN--PPKDYNPNGNG-YEPIDNGAYYVDPPQGRPYFKPTPFP 89 PY+ N PP Y+P+ Y+ Y PP PY+ PTP P Sbjct: 612 PYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPTPKP 654 >At5g44780.1 68418.m05488 expressed protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 723 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 190 DYNP-NGNGYEPIDNGAYYVDPPQGR 116 +Y+P NG Y P G +Y PPQG+ Sbjct: 530 NYSPQNGGHYGPAQFGQWYPGPPQGQ 555 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 190 DYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 89 DY P+ Y+P N Y PP Y +P +P Sbjct: 101 DYQPSPYPYQPQGNFGAYGPPPPHYSYQEPAQYP 134 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 199 PPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 89 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 >At5g44400.1 68418.m05436 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 537 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = +2 Query: 29 LIHYFVINFLRYSLLPTASTRERGRLEVRSALGRVHVICTVVDRFVAVSIRVVIFGRIND 208 L V+ F Y++ PT+S + HV + F A + V +F ++ + Sbjct: 9 LFSILVLYFSLYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPTKNVSMFSQVLE 68 Query: 209 VRAVVNRFVAVSWPL-GSVVGPVY 277 A RF+ S P G + P++ Sbjct: 69 STAQNLRFLKKSMPKPGFIFSPIH 92 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 27.5 bits (58), Expect = 8.7 Identities = 27/100 (27%), Positives = 34/100 (34%), Gaps = 6/100 (6%) Frame = -3 Query: 373 PGHVLISNPDPGFSRP----VIGQPGYVPISTGPAYVXXXXXXXXXXXNGYEPIDNRPYI 206 P +V S P +S P V P YV S P Y PY+ Sbjct: 84 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYV 143 Query: 205 VN--PPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPF 92 + PP Y+P Y P + Y PP Y P P+ Sbjct: 144 YSSPPPYAYSPPPYAYSPPPSPYVYKSPPY--VYSSPPPY 181 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 199 PPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFPGARG 77 PP+ Y P +GY P A Y PP P P +PG G Sbjct: 44 PPQGYPPPPHGYPP----AAYPPPPGAYP---PAGYPGPSG 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,959,857 Number of Sequences: 28952 Number of extensions: 316153 Number of successful extensions: 859 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -