BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k10f (600 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U65402-1|AAC51375.1| 319|Homo sapiens seven transmembrane G-cou... 31 2.3 BC095537-1|AAH95537.1| 318|Homo sapiens GPR31 protein protein. 31 2.3 AL121935-2|CAB99329.1| 319|Homo sapiens G protein-coupled recep... 31 2.3 BC068505-1|AAH68505.1| 644|Homo sapiens zinc finger protein 746... 30 5.4 AK128244-1|BAC87351.1| 459|Homo sapiens protein ( Homo sapiens ... 30 5.4 AK055975-1|BAB71061.1| 242|Homo sapiens protein ( Homo sapiens ... 30 5.4 X74955-1|CAA52910.1| 622|Homo sapiens mucin protein. 30 7.1 AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-ty... 30 7.1 AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-ty... 30 7.1 AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-ty... 30 7.1 AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-ty... 30 7.1 AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-ty... 30 7.1 AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-ty... 30 7.1 AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein. 30 7.1 J04543-1|AAA36616.1| 466|Homo sapiens protein ( Human synexin m... 29 9.4 CR407686-1|CAG28614.1| 466|Homo sapiens ANXA7 protein. 29 9.4 BT007187-1|AAP35851.1| 466|Homo sapiens annexin A7 protein. 29 9.4 BC002632-1|AAH02632.1| 466|Homo sapiens annexin A7 protein. 29 9.4 AL512656-2|CAI15291.1| 466|Homo sapiens annexin A7 protein. 29 9.4 AL512656-1|CAI15290.1| 488|Homo sapiens annexin A7 protein. 29 9.4 AL353731-4|CAI52485.1| 466|Homo sapiens annexin A7 protein. 29 9.4 AL353731-3|CAI52484.1| 488|Homo sapiens annexin A7 protein. 29 9.4 AL353731-2|CAI52483.1| 144|Homo sapiens annexin A7 protein. 29 9.4 AK222552-1|BAD96272.1| 466|Homo sapiens annexin VII isoform 1 v... 29 9.4 AB062429-1|BAB93492.1| 466|Homo sapiens annexin A7 protein. 29 9.4 >U65402-1|AAC51375.1| 319|Homo sapiens seven transmembrane G-coupled receptor protein. Length = 319 Score = 31.5 bits (68), Expect = 2.3 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 301 WLLSTTLTCPGLLLS---TTFTP*RFFASRTESAFS 203 WLL LTCPGLL+S T F SR + +FS Sbjct: 139 WLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFS 174 >BC095537-1|AAH95537.1| 318|Homo sapiens GPR31 protein protein. Length = 318 Score = 31.5 bits (68), Expect = 2.3 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 301 WLLSTTLTCPGLLLS---TTFTP*RFFASRTESAFS 203 WLL LTCPGLL+S T F SR + +FS Sbjct: 138 WLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFS 173 >AL121935-2|CAB99329.1| 319|Homo sapiens G protein-coupled receptor 31 protein. Length = 319 Score = 31.5 bits (68), Expect = 2.3 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 301 WLLSTTLTCPGLLLS---TTFTP*RFFASRTESAFS 203 WLL LTCPGLL+S T F SR + +FS Sbjct: 139 WLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFS 174 >BC068505-1|AAH68505.1| 644|Homo sapiens zinc finger protein 746 protein. Length = 644 Score = 30.3 bits (65), Expect = 5.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 495 PNGNGYEPIDNGAYYVDPPQG-RPYFRPTPFPG 590 P G Y DNG +DP Q RP+ P +PG Sbjct: 397 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPG 429 >AK128244-1|BAC87351.1| 459|Homo sapiens protein ( Homo sapiens cDNA FLJ46378 fis, clone TESTI4052775. ). Length = 459 Score = 30.3 bits (65), Expect = 5.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 495 PNGNGYEPIDNGAYYVDPPQG-RPYFRPTPFPG 590 P G Y DNG +DP Q RP+ P +PG Sbjct: 212 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPG 244 >AK055975-1|BAB71061.1| 242|Homo sapiens protein ( Homo sapiens cDNA FLJ31413 fis, clone NT2NE2000259, moderately similar to OOCYTE ZINC FINGER PROTEIN XLCOF6.1. ). Length = 242 Score = 30.3 bits (65), Expect = 5.4 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 495 PNGNGYEPIDNGAYYVDPPQG-RPYFRPTPFPG 590 P G Y DNG +DP Q RP+ P +PG Sbjct: 43 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPG 75 >X74955-1|CAA52910.1| 622|Homo sapiens mucin protein. Length = 622 Score = 29.9 bits (64), Expect = 7.1 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +1 Query: 403 TGPTTDPKGQETATNLLTTARTSLILPKITT--LMETATNL----STTVHITWTLPKADL 564 T P T P + ++ RT+ LP +TT TAT++ S+T+ T TLP+ Sbjct: 114 TSPATTPTATSSKATSSSSPRTATTLPVLTTTATKSTATSVTPIPSSTLGTTGTLPEQTT 173 Query: 565 TSGLPLSLV 591 T +S + Sbjct: 174 TPVATMSTI 182 >AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1086 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 523 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 569 >AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1094 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 523 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 569 >AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1133 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 562 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 608 >AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1086 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 523 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 569 >AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1094 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 523 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 569 >AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1133 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 562 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 608 >AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein. Length = 1109 Score = 29.9 bits (64), Expect = 7.1 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 447 PIDNRPYIVNPPKDYNPNGNGYEPIDN-GAYYVDPPQGRPYFRPTPF 584 P D P V P P G+ P YY DP P F P P+ Sbjct: 538 PADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPY 584 >J04543-1|AAA36616.1| 466|Homo sapiens protein ( Human synexin mRNA, complete cds. ). Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >CR407686-1|CAG28614.1| 466|Homo sapiens ANXA7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >BT007187-1|AAP35851.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >BC002632-1|AAH02632.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AL512656-2|CAI15291.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AL512656-1|CAI15290.1| 488|Homo sapiens annexin A7 protein. Length = 488 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AL353731-4|CAI52485.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AL353731-3|CAI52484.1| 488|Homo sapiens annexin A7 protein. Length = 488 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AL353731-2|CAI52483.1| 144|Homo sapiens annexin A7 protein. Length = 144 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AK222552-1|BAD96272.1| 466|Homo sapiens annexin VII isoform 1 variant protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 >AB062429-1|BAB93492.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 29.5 bits (63), Expect = 9.4 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +3 Query: 438 GYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFRPTPFPG 590 GY P PP P +G+ P+ GAY P G P P PG Sbjct: 16 GYPPAGQESSF--PPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPG 64 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,854,481 Number of Sequences: 237096 Number of extensions: 2014579 Number of successful extensions: 11815 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 11602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11805 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -