BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k09r (745 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0620 - 26196597-26196841,26196929-26197020,26197118-26197296 192 2e-49 01_06_0087 + 26299692-26299971,26301721-26301933,26302027-263024... 30 1.7 08_02_0039 - 11512553-11512822,11512920-11513171,11513784-115139... 29 5.2 >03_05_0620 - 26196597-26196841,26196929-26197020,26197118-26197296 Length = 171 Score = 192 bits (469), Expect = 2e-49 Identities = 95/142 (66%), Positives = 108/142 (76%) Frame = -2 Query: 615 KIQPILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYG 436 K+ P+LK +LSENA P RGS AAG DL SA + VPARGK +V TDL I +P G Y Sbjct: 29 KVAPLLKVKKLSENAVLPSRGSALAAGYDLSSAAEVVVPARGKAMVPTDLSIAIPEGTYA 88 Query: 435 RVAPRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIYYP 256 RVAPRSGLALK+ IDVGAGVID DYRG VGV+LFNHSDTDF+VK GDRIAQ+I E I P Sbjct: 89 RVAPRSGLALKHSIDVGAGVIDADYRGPVGVILFNHSDTDFAVKPGDRIAQMIIEVIVTP 148 Query: 255 VLQEVANLSVTQRGDGGFGSTG 190 + EV +L T RG+GGFGSTG Sbjct: 149 EVAEVEDLDATVRGEGGFGSTG 170 >01_06_0087 + 26299692-26299971,26301721-26301933,26302027-26302464, 26304500-26304708 Length = 379 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/80 (25%), Positives = 32/80 (40%) Frame = -2 Query: 432 VAPRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIYYPV 253 +A GLA I VGAG D + N ++ ++ F +KG I + + Sbjct: 93 IAQEFGLANVTAIQVGAGPADFPHGANFAIISSTANNASFFARKGLDITPFSLDTQMFWF 152 Query: 252 LQEVANLSVTQRGDGGFGST 193 + L+ G GG G + Sbjct: 153 RTHLQQLTQQLNGGGGGGGS 172 >08_02_0039 - 11512553-11512822,11512920-11513171,11513784-11513951, 11519429-11519622,11519774-11519795,11519928-11520239, 11520497-11520826,11520855-11521069,11523106-11523151, 11523207-11523290 Length = 630 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 411 LNQIEVLLYHNTQAVVLFVG--QFSLILC 491 + Q+EVL Y Q +LF+G QFS I+C Sbjct: 462 VEQLEVLKYWEAQMSILFLGYKQFSRIIC 490 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,376,682 Number of Sequences: 37544 Number of extensions: 291455 Number of successful extensions: 532 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -