BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k09f (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35498| Best HMM Match : dUTPase (HMM E-Value=6.1) 83 1e-16 SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 >SB_35498| Best HMM Match : dUTPase (HMM E-Value=6.1) Length = 90 Score = 83.4 bits (197), Expect = 1e-16 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = +3 Query: 366 KIQPILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYG 545 + + +L F +L++ P RGS AAG DL SAYD ++PA+GK LVKTD+ + +P GCYG Sbjct: 20 RAETVLYFKKLTKLGLPPTRGSSHAAGYDLYSAYDVSIPAQGKALVKTDIAVAIPDGCYG 79 Query: 546 RVAPRS 563 RVAPRS Sbjct: 80 RVAPRS 85 >SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 10 RANSRHKQKLFSINVRCFCPKRITATINFLRTKIEK 117 RA + LFS+N FCP +++ N L +E+ Sbjct: 186 RAVTAFSNSLFSLNSNAFCPDQVSELENRLEKLVER 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,846,494 Number of Sequences: 59808 Number of extensions: 260058 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -