BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k04f (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35461| Best HMM Match : No HMM Matches (HMM E-Value=.) 147 7e-36 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 86 2e-17 SB_22908| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48675| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_37509| Best HMM Match : PAE (HMM E-Value=0) 30 1.3 SB_59641| Best HMM Match : PAE (HMM E-Value=0) 30 1.3 SB_56875| Best HMM Match : LON (HMM E-Value=0) 30 1.7 SB_40706| Best HMM Match : Extensin_2 (HMM E-Value=7.9) 29 3.8 SB_16876| Best HMM Match : Hydrolase (HMM E-Value=1.8e-06) 28 6.7 SB_32744| Best HMM Match : Sulfatase (HMM E-Value=0) 28 6.7 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_35461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 147 bits (356), Expect = 7e-36 Identities = 68/134 (50%), Positives = 95/134 (70%), Gaps = 1/134 (0%) Frame = +1 Query: 190 DSDGDGIGDLNGITSKLEYIKELGVGAVWLSPIFKSPMVDFGYDIANFYEIHHEYGTMED 369 DS+GDG GDL+GI S+L+Y+ LGV ++LSPIFKSPMVD GYD+++F +++ +GTMED Sbjct: 41 DSNGDGNGDLSGIRSRLDYLDYLGVKIIYLSPIFKSPMVDNGYDVSDFMDVNPMFGTMED 100 Query: 370 FEALLKKANELDIKVVLDLVPNHTSNESVWFQEA-LNGNEKYYNYFVWEDGIIDENGNRQ 546 FE+LL+ + +K++LD VPNHTS++ WF E+ N + +++W D D Sbjct: 101 FESLLQDIHSRGMKLLLDFVPNHTSDQHDWFLESRSNRHNPRREWYIWRDAASDGT---- 156 Query: 547 PPNNWLSHFRGSAW 588 PPNNWLS F GSAW Sbjct: 157 PPNNWLSVFGGSAW 170 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 86.2 bits (204), Expect = 2e-17 Identities = 52/182 (28%), Positives = 94/182 (51%), Gaps = 1/182 (0%) Frame = +1 Query: 49 ILLTTMKTVCLLSLLFVACSGIIIKNGEVQDWWETSILYQIYPRSFADSDGDGIGDLNGI 228 ++L + ++ ++ C+ +++ + + W E ++Y+I + F + L GI Sbjct: 619 VILAMIVAAVVIIIVAPKCAKAKVRDMD-KSWLENEVVYKISAQQFNKN-------LTGI 670 Query: 229 TSKLEYIKELGVGAVWLSPIFKSPMVDFGYDIANFYEIHHEYGTMEDFEALLKKANELDI 408 KL Y++ LGV + + +F + ++++ G MEDF+ LLKKA++ + Sbjct: 671 IDKLGYLENLGVKVLSIGAVFSEE---------DLQDVNNALGKMEDFQNLLKKAHDRKM 721 Query: 409 KVVLDLVPNHTSNESVWFQE-ALNGNEKYYNYFVWEDGIIDENGNRQPPNNWLSHFRGSA 585 +V++D VPNHTS ++ WF+E ++N N++VW D NNW S GSA Sbjct: 722 RVIVDFVPNHTSKKNKWFEESSVNKTNSKRNWYVWRDS----------ANNWPSMNGGSA 771 Query: 586 WE 591 WE Sbjct: 772 WE 773 >SB_22908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 769 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +1 Query: 310 FGYDIANFYEIHHEYGTMEDFEALLKKANELDIKVVLDLVPNHTSNESVWFQEALNGNEK 489 FGY + +F+ YGT ++ L+ A+ I V+LD+V +H + + +G E Sbjct: 361 FGYQVTSFFAASSRYGTPDELRLLIDTAHSYGIVVLLDIVHSHAAKNVMDGLNQFDGTEG 420 Query: 490 YY 495 Y Sbjct: 421 CY 422 >SB_48675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1329 Score = 31.1 bits (67), Expect = 0.72 Identities = 20/93 (21%), Positives = 45/93 (48%), Gaps = 9/93 (9%) Frame = +1 Query: 208 IGDLNGITSKLEYIKELGVGAVWLSPIFKSPMVDFGYDIANFYEIHHEY--------GTM 363 +G L+ +++L+ ++ G + +PI + Y I + +++ + T Sbjct: 411 LGPLSQWSARLQISRDSGYNVIHFTPISELGRSHSSYSIVDQLKLNCRFDEPGSKKGATF 470 Query: 364 EDFEALLKKAN-ELDIKVVLDLVPNHTSNESVW 459 + + +L K E + ++D+V NHT+NE+ W Sbjct: 471 PEVKKILNKMKTEWKMLSIVDIVLNHTANETEW 503 >SB_37509| Best HMM Match : PAE (HMM E-Value=0) Length = 483 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 517 GIIDENGNRQPPNNWLSHFRGSAWEYKEE 603 G G+ + +NW+ HF G AW Y EE Sbjct: 104 GYYYREGSGKGSDNWVLHFFGGAWCYDEE 132 >SB_59641| Best HMM Match : PAE (HMM E-Value=0) Length = 1252 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 517 GIIDENGNRQPPNNWLSHFRGSAWEYKEE 603 G G+ + +NW+ HF G AW Y EE Sbjct: 873 GYYYREGSGKGSDNWVLHFFGGAWCYDEE 901 >SB_56875| Best HMM Match : LON (HMM E-Value=0) Length = 925 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 277 LSPIFKSPMVDFGYDIANFYEIHHEYGTMEDFEALLKKANELDIKVVLDLV 429 L P+ ++P+ + Y+I M DF L K+ N+++ K ++DLV Sbjct: 140 LIPVHRNPVFPRFVKMLEVYQISEFRKNMNDFGPLGKQVNQINDKSLMDLV 190 >SB_40706| Best HMM Match : Extensin_2 (HMM E-Value=7.9) Length = 301 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/63 (31%), Positives = 29/63 (46%) Frame = -2 Query: 263 TPNSLIYSNFEVIPFKSPIPSPSLSAKDLG*IWYKIEVSHQS*TSPFFIMIPLHATKSKD 84 T + L+Y + +PF S IP +L KD Y + + S PF IP+ KD Sbjct: 216 THHYLLYQGYPSLPFISRIPITTLYIKDTH--QYPLYQGYPS--LPFISRIPITTLYIKD 271 Query: 83 SKH 75 + H Sbjct: 272 THH 274 >SB_16876| Best HMM Match : Hydrolase (HMM E-Value=1.8e-06) Length = 595 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 472 LNGNEKYYNYFVWEDGIIDENGNRQPPNNWLSHFRGSAWEYKEE 603 L GN KYYNY V +G +++G + + SA + EE Sbjct: 443 LVGNSKYYNYTVSVNGKAEKHGGDYKEDYFTDVITRSAVSFLEE 486 >SB_32744| Best HMM Match : Sulfatase (HMM E-Value=0) Length = 485 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 472 LNGNEKYYNYFVWEDGIIDENGNRQPPNNWLSHFRGSAWEYKEE 603 L GN KYYNY V +G +++G + + SA + EE Sbjct: 140 LVGNSKYYNYTVSVNGKAEKHGGDYKEDYFTDVITRSAVSFLEE 183 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 6/35 (17%) Frame = -1 Query: 561 PIIRWLPI------SIFVYDSVFPNEIIVIFFVAI 475 P++R LPI S+ +YD+ FP E+ +F V I Sbjct: 969 PVVRELPITNTFSFSVIIYDATFPPEVQNLFSVII 1003 >SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 414 CFGSCTKSYIKRKCLVPRSSQWQRK 488 CFGSC+K++IK + L+ ++ QRK Sbjct: 108 CFGSCSKAFIKLE-LLDNVTEEQRK 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,212,601 Number of Sequences: 59808 Number of extensions: 412613 Number of successful extensions: 1487 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -