BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10k02r (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 3.9 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.9 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 181 DELTANLVLRLPESIDIYNVNNATQLEI*ILRSQYSY 291 D LT + L+L + ID+ N + + +S Y Y Sbjct: 48 DALTVKIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDY 84 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 172 SWVDELTANLVLRLPESIDI 231 SW+D+LT L + ES+++ Sbjct: 238 SWLDQLTNLGFLGMKESVEV 257 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 172 SWVDELTANLVLRLPESIDI 231 SW+D+LT L + ES+++ Sbjct: 276 SWLDQLTNLGFLGMKESVEV 295 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,836 Number of Sequences: 438 Number of extensions: 4828 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -