BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j24r (754 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9163| Best HMM Match : XS (HMM E-Value=0.84) 29 5.4 SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) 28 9.4 >SB_9163| Best HMM Match : XS (HMM E-Value=0.84) Length = 424 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 425 CKPMCVLLVCEFNLFREK*KK 487 CKP C +L C N FR K KK Sbjct: 377 CKPNCPILCCRSNPFRVKGKK 397 >SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) Length = 852 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 540 KRVILFWNNLIIAFVCLYFFYFSRNRLNSQTSKTHIGLHFCLRLIAK 400 K V + WN + + V + + +LN Q + ++GLH L+ I + Sbjct: 365 KAVAIIWNAMKLVSVHPQWIVDAAKKLNPQVAAGNVGLHPVLKTITR 411 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,824,190 Number of Sequences: 59808 Number of extensions: 373285 Number of successful extensions: 738 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -