BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j24r (754 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70210-9|CAE17897.1| 403|Caenorhabditis elegans Hypothetical pr... 29 3.5 Z82278-4|CAB05257.2| 487|Caenorhabditis elegans Hypothetical pr... 29 4.7 Z81541-6|CAB04413.2| 326|Caenorhabditis elegans Hypothetical pr... 28 6.2 >Z70210-9|CAE17897.1| 403|Caenorhabditis elegans Hypothetical protein K08H2.9 protein. Length = 403 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 Query: 546 RPKRVILFWNNLIIAFVCLYFFYFSRNRLNSQT 448 RP FW L I +CLY F FS N +T Sbjct: 3 RPHARTRFWIFLSIFAICLYIFGFSERNYNLKT 35 >Z82278-4|CAB05257.2| 487|Caenorhabditis elegans Hypothetical protein M162.5 protein. Length = 487 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -3 Query: 725 IFLFYLTNAFFTALTVIILITFDIPILGPKCDLNAFFARRLIVSSNY 585 I + L FF A + L TF IPI+ P D N F R + +Y Sbjct: 111 ISTYGLRKVFFAAGMLTSLTTFLIPIVAP-MDFNLFLLMRFLQGMSY 156 >Z81541-6|CAB04413.2| 326|Caenorhabditis elegans Hypothetical protein F48F5.4 protein. Length = 326 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = -3 Query: 692 TALTVIILITFDIPILGPKCDLNAFFARRLIVSSNYFKDCTFIIQFLRKGLN 537 TAL +I TF PI+G A + SSN K +++FL KGLN Sbjct: 190 TAL-FLIAATFYYPIVGSYWRYQAMKILKTHSSSNTSKGTLVLLRFLIKGLN 240 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,462,319 Number of Sequences: 27780 Number of extensions: 315301 Number of successful extensions: 727 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -