BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j24f (634 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 2.6 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 25 2.6 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 23 8.1 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 198 ARTQPANKMAATELGRYKNIVTALITGNYVSLI 100 A T PA A LG Y N + ++ + VS I Sbjct: 264 AETMPATSDAVPLLGTYFNCIMFMVASSVVSTI 296 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 198 ARTQPANKMAATELGRYKNIVTALITGNYVSLI 100 A T PA A LG Y N + ++ + VS I Sbjct: 296 AETMPATSDAVPLLGTYFNCIMFMVASSVVSTI 328 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 23.0 bits (47), Expect = 8.1 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -3 Query: 632 CGSPAPCVFARIHRRPGW 579 CGS P ++ ++H W Sbjct: 356 CGSSTPAIYTKVHPYLDW 373 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,201 Number of Sequences: 2352 Number of extensions: 11752 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -