BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j17r (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 4.0 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.9 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 9.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.1 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 207 KVSIFH-HGNHAITIHRLPSKELK 275 K+ +F H N IT++R P + K Sbjct: 151 KIHVFSLHDNKLITMYRFPQNQFK 174 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 259 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 357 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 259 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 357 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = +1 Query: 598 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIKTE 702 +F+L VS I++ V + IF+ + W + ++++ + Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVRRD 264 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/39 (30%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 503 ADEGTDSAVESG-VDIVLNHRLVETYAFGDKKSYTLYLK 390 +DE +A++SG + +N+ L++T +GD K++ + +K Sbjct: 44 SDEKRQAAIQSGDYNYTMNY-LLDTDQWGD-KTFVIIMK 80 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -3 Query: 290 GRFKELQFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGL 162 G++ +Q + + + M+E RD + P + KHGL Sbjct: 73 GQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGL 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,996 Number of Sequences: 438 Number of extensions: 4108 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -