BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j16f (411 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) 134 4e-32 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.37 SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) 28 3.4 SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) 27 4.5 SB_14817| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) 27 7.9 >SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) Length = 115 Score = 134 bits (323), Expect = 4e-32 Identities = 68/115 (59%), Positives = 78/115 (67%) Frame = +1 Query: 22 PPKKDAKASAKQPQXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNQVLFDKPTYEKLYKEV 201 PPKKD K AK+PQ LNN VLFDK TY+KLYKEV Sbjct: 1 PPKKDPKKDAKKPQKAQKPAGSGGGKAKKKKWSKGKVRDK-LNNLVLFDKATYDKLYKEV 59 Query: 202 PQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATKGDD 366 P Y+LITP+VVSERLK+RGSLARRAL+EL+ KGLIK+V +HH Q+IYTRATKG D Sbjct: 60 PSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKHHSQLIYTRATKGAD 114 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 31.1 bits (67), Expect = 0.37 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = -2 Query: 326 WCWTTCLMRPFSLSSMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGLSNNTWLF 147 WC +RPF LSS++ L R + ++ GV GT S G++ W Sbjct: 2144 WCGPVYFVRPFCLSSIAYRLIRA-----IMSSSLGVACSPVGTKAPGVSSGGITRTIWSA 2198 Query: 146 NLSRTFPL 123 + +R P+ Sbjct: 2199 SRTREMPV 2206 >SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) Length = 191 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 4 FSNSKMPPKKDAKASAKQPQ 63 F+ SKMP KK AKA+ QP+ Sbjct: 47 FAISKMPSKKGAKAAEAQPE 66 >SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) Length = 1244 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 200 TSLYSFSYVGLSNNTWLFNLSRTFPLDH 117 +SL+ G+SN+ WL N S T P++H Sbjct: 250 SSLHIEKENGISNDDWLSNPSFTSPIEH 277 >SB_14817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 26.6 bits (56), Expect = 7.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 53 NSLKKHRRRRKDPVAAKPRRRSGPK 127 N KH ++K PV P+R GPK Sbjct: 304 NDKHKHNSKQKTPVVYFPKRPYGPK 328 >SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) Length = 683 Score = 26.6 bits (56), Expect = 7.9 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -2 Query: 155 WLFNLSRTFPLDHFFFLALPPPDPSFFFC--VF*GCLAEAFASF 30 WL + TFPL + + + P DP ++C +F G +F S+ Sbjct: 154 WLAATAITFPLFMYSKMVMSPFDPDTYWCFVLFPGDSLSSFPSY 197 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,219,435 Number of Sequences: 59808 Number of extensions: 287342 Number of successful extensions: 924 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -