BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j15r (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 32 0.28 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 32 0.28 At1g01150.1 68414.m00024 expressed protein ; expression supporte... 31 0.49 At5g62380.1 68418.m07829 no apical meristem (NAM) family protein... 30 1.1 At1g30450.3 68414.m03722 cation-chloride cotransporter, putative... 29 2.6 At1g30450.2 68414.m03721 cation-chloride cotransporter, putative... 29 2.6 At1g30450.1 68414.m03720 cation-chloride cotransporter, putative... 29 2.6 At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein ... 29 3.5 At4g33600.1 68417.m04773 expressed protein 28 6.1 At4g11530.1 68417.m01850 protein kinase family protein contains ... 28 6.1 At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr... 28 6.1 At3g06080.2 68416.m00695 expressed protein identical to unknown ... 27 8.0 At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containi... 27 8.0 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 32.3 bits (70), Expect = 0.28 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 331 NTLGYYDTLLDNSTLLDIWAEVDGMCYSYDAHILV 435 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 32.3 bits (70), Expect = 0.28 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 331 NTLGYYDTLLDNSTLLDIWAEVDGMCYSYDAHILV 435 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g01150.1 68414.m00024 expressed protein ; expression supported by MPSS Length = 345 Score = 31.5 bits (68), Expect = 0.49 Identities = 24/106 (22%), Positives = 50/106 (47%) Frame = +1 Query: 232 VFFVGHNEFELVEVAVRCTATLNGSSPSEQINKNTLGYYDTLLDNSTLLDIWAEVDGMCY 411 V + + E L E + + T+N + P ++I + G + T ++S L D W ++ + Sbjct: 235 VLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSDLKDKWRNMNYLDL 294 Query: 412 SYDAHILVVILLRELGMVNGKVNIRYFTWLTTTGRSSDNATVCRIV 549 + I ++I++ E+G NG+ R + R+ +C +V Sbjct: 295 -VEVEIDIIIVVAEIGDQNGEGKKRRSDEEDESNRNHPKIRICGMV 339 >At5g62380.1 68418.m07829 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; OsNAC7, Oryza sativa, EMBL:AB028186 Length = 348 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 156 GRDYDNTDLGAPAFFQNALVGIVSFGKSNSNDAYPVVLTSISSFTEWILQ 7 G Y DL +P FQ + +S N D Y VVL++I++ I+Q Sbjct: 190 GNYYHLPDLESPRMFQGSSSSSLSSLHQNDQDPYGVVLSTINATPTTIMQ 239 >At1g30450.3 68414.m03722 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 576 LKGSGSW*EQYQRTVGTIDSRW 641 +KG W +YQR GTID W Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYW 788 >At1g30450.2 68414.m03721 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 576 LKGSGSW*EQYQRTVGTIDSRW 641 +KG W +YQR GTID W Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYW 788 >At1g30450.1 68414.m03720 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 576 LKGSGSW*EQYQRTVGTIDSRW 641 +KG W +YQR GTID W Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYW 788 >At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 446 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = -2 Query: 234 NCRNQYKDHDRVVTDHKFCAGLVRDGGRDYDNTDLGAPAFFQNALVGIVSFGKSNSN 64 +C + D +T FC L + R APA+ NAL V+ G N N Sbjct: 175 DCGTLFSRKDSFITHRAFCDALAEESARFVSVPP--APAYLNNALDVEVNHGNINQN 229 >At4g33600.1 68417.m04773 expressed protein Length = 453 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 637 LESMVPTVRWYCSHQLPLPFNXYLFPWRILR 545 L +MVP V W HQ P L+ W LR Sbjct: 183 LSAMVPFVAWSLRHQCENPQRWVLYHWGELR 213 >At4g11530.1 68417.m01850 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 931 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -2 Query: 639 ILNQWFQQCAGIVLTNYHYLSTXTCFHGEF-----YDPAYRRIIA 520 +LN F L + Y+ST TCF+G F YD RRI++ Sbjct: 2 MLNTLFLPIFLFFLITFDYVSTQTCFNGYFKPNGTYDLNRRRILS 46 >At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 284 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 284 ALPP*TVVPHPSRSTKIPWGITTPCWIIAPCWIFGP 391 A+PP ++ HPS + +G P I APC + P Sbjct: 134 AMPPGSIPMHPSMPSYTYFGNQNPSMIPAPCPTYMP 169 >At3g06080.2 68416.m00695 expressed protein identical to unknown protein GB:AAF30301 from [Arabidopsis thaliana] Length = 469 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 114 RRQGHPSQYYRSHGHHPGPNRRRIC 188 R+ GHPS YY H P P R+ C Sbjct: 402 RKDGHPSLYYLG-PHGPAPLHRQDC 425 >At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 656 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 141 NTDLGAPAFFQNALVGIVSFGKSNSNDAYPVVLTSIS 31 N +G AF NA + FG SN YP +T +S Sbjct: 479 NAMIGGYAFHGNASEALNLFGSMKSNGIYPSHITFVS 515 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,935,040 Number of Sequences: 28952 Number of extensions: 370850 Number of successful extensions: 976 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -