BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j11r (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 2.8 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 3.7 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 GSYLNLFLVMVII*KEVQNNRQYYLRV*NTYLFDVT-NLCTKEC 290 GS++ ++ VI +E + + Y TYLFD+ N ++C Sbjct: 519 GSFVTQYVGEVITNEEAEKRGKEYDAAGRTYLFDLDYNESEEQC 562 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 129 ITKIQLSIFLTGSYLNLFLVMVII*K-EVQNNRQYYL 236 +T I + IF+TG + N+ VII +Q YYL Sbjct: 43 LTIIYMIIFVTGIFGNITTCTVIIKNPAMQTATNYYL 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,064 Number of Sequences: 438 Number of extensions: 3295 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -