BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j10r (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 24 1.2 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 24 1.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.8 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 3.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.6 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.7 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 8.7 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 Query: 225 GRSENYKFHLTDYYPVHNP 169 GR Y F L Y P H P Sbjct: 53 GRRHRYNFQLKPYNPEHKP 71 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 Query: 225 GRSENYKFHLTDYYPVHNP 169 GR Y F L Y P H P Sbjct: 54 GRRHRYNFQLKPYNPEHKP 72 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/73 (20%), Positives = 31/73 (42%) Frame = -3 Query: 678 PRDVTVYTYPDIPDYPTDGKVVLLFPGAEAKSVRDLFNQQQNQPSYSEIMLSQLPVGYNV 499 PR++ Y D+ + K+ L +++ DL+N + SY+ M + N+ Sbjct: 368 PRNIDEYNNNDLDTKKWNNKISAL------RALNDLYNVKNTLDSYNGSMEINQNIAQNI 421 Query: 498 GTLMKKIVTRKDN 460 I+ ++N Sbjct: 422 DHAKNTIIDYRNN 434 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 645 IPDYPTDGKVVLLFPGAEAKSVRDLFNQQQNQPSYSE 535 + DY +GKV+LL KS +++ + + Y E Sbjct: 128 VADYKIEGKVLLLPVRGAGKSNITMYDLKSHNDIYCE 164 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 4 CSRDRSREYKKKDRRYDQLHNVEEKH 29 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 234 CAWGRSENYKFHLTDYYPVHNPDQNH 157 C+ RS YK Y +HN ++ H Sbjct: 253 CSRDRSREYKKKDRRYDQLHNVEEKH 278 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 678 PRDVTV-YTYPDIPDYPTDGKVVLLFPGA 595 P VT T D+P P D KVV+ P A Sbjct: 1201 PTTVTYCQTEEDVPGSPADIKVVVSSPQA 1229 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 678 PRDVTV-YTYPDIPDYPTDGKVVLLFPGA 595 P VT T D+P P D KVV+ P A Sbjct: 1197 PTTVTYCQTEEDVPGSPADIKVVVSSPQA 1225 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 175 MHRIVICKVEFVIF 216 MH I+ C++EF ++ Sbjct: 110 MHAIIACQMEFQLY 123 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 461 LSFLVTIFFINVPTL*PTGSCDN 529 L++ + FF+++ + P GSC+N Sbjct: 81 LAWAIFYFFMSMRSELPWGSCNN 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,108 Number of Sequences: 438 Number of extensions: 5282 Number of successful extensions: 27 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -