BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j08r (492 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.46 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 4.3 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 5.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.5 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 7.5 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 23 7.5 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 22 9.9 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 22 9.9 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 22 9.9 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 22 9.9 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 22 9.9 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 22 9.9 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 22 9.9 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 26.6 bits (56), Expect = 0.46 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 152 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 51 R++ +R +E +L EA A + N + QP PP Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 24.6 bits (51), Expect = 1.9 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -2 Query: 167 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 24 KH C + +E +++ KEA +T+NL + +A + GT Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 4.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 313 TAPLPLMSTMSPTLYTFMYVE 375 TA +P S + PTL+ MY E Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.0 bits (47), Expect = 5.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 253 VTLYTRPVFPWYTLCGIP 306 V ++ RP PW+++ GIP Sbjct: 73 VGIFGRPGRPWWSVPGIP 90 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 7.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 189 DALRYNPSANTLVDNHTESMSSHVVH 266 DA+R + + +V NH E S+ +H Sbjct: 3072 DAIRIGSNESIVVPNHMERSSASSLH 3097 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.6 bits (46), Expect = 7.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 402 VPHTWNYSALHVHESVQS 349 V +TWNY+A V + V S Sbjct: 282 VENTWNYTAADVADLVDS 299 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 22.6 bits (46), Expect = 7.5 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = -2 Query: 266 VYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 111 ++ + H GV+V+ + R + EH++H R K + NE++ Sbjct: 117 LFQIGQHVRGVLVSIKSRMMAYTNDAVAKFEHLRHRTMRAVKRKMDELNEQI 168 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 313 TAPLPLMSTMSPTLYTFMY 369 TA +P S + PTL+ MY Sbjct: 683 TAGVPQGSILGPTLWNIMY 701 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.2 bits (45), Expect = 9.9 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 252 CSCSRCDCQQA 220 C+C RC C ++ Sbjct: 42 CNCGRCSCDES 52 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.2 bits (45), Expect = 9.9 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 252 CSCSRCDCQQA 220 C+C RC C ++ Sbjct: 42 CNCGRCSCDES 52 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.2 bits (45), Expect = 9.9 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 252 CSCSRCDCQQA 220 C+C RC C ++ Sbjct: 42 CNCGRCSCDES 52 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 22.2 bits (45), Expect = 9.9 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 252 CSCSRCDCQQA 220 C+C RC C ++ Sbjct: 42 CNCGRCSCDES 52 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.2 bits (45), Expect = 9.9 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 252 CSCSRCDCQQA 220 C+C RC C ++ Sbjct: 618 CNCGRCSCDES 628 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 313 TAPLPLMSTMSPTLYTFMY 369 TA +P S + PTL+ MY Sbjct: 629 TAGVPQGSILGPTLWNIMY 647 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,857 Number of Sequences: 2352 Number of extensions: 11276 Number of successful extensions: 66 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -