BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j06r (566 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051964-1|AAK93388.1| 1266|Drosophila melanogaster LD43047p pro... 29 3.3 AE014297-1339|AAG22146.2| 1266|Drosophila melanogaster CG14712-P... 29 3.3 Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein. 29 5.8 Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein. 29 5.8 AY051596-1|AAK93020.1| 969|Drosophila melanogaster GH23814p pro... 29 5.8 AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB,... 29 5.8 AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA,... 29 5.8 AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC,... 29 5.8 >AY051964-1|AAK93388.1| 1266|Drosophila melanogaster LD43047p protein. Length = 1266 Score = 29.5 bits (63), Expect = 3.3 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -1 Query: 314 NNLPAGNIFFLEAVQPFTSCAIGFRGAAVSLSGTYEL-RSLVTHVADNSRSLTRQRFHLT 138 NN PA + F L + P +G+ SL+GT RSL+ A +S ++TRQ+ L Sbjct: 26 NNRPAASNF-LRGLSP--------KGSNTSLNGTRTPERSLMNRSATSSSTITRQK--LN 74 Query: 137 LQEIKPRNSQIVEES 93 L ++ PR V S Sbjct: 75 LSQVDPRTFADVHSS 89 >AE014297-1339|AAG22146.2| 1266|Drosophila melanogaster CG14712-PA protein. Length = 1266 Score = 29.5 bits (63), Expect = 3.3 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -1 Query: 314 NNLPAGNIFFLEAVQPFTSCAIGFRGAAVSLSGTYEL-RSLVTHVADNSRSLTRQRFHLT 138 NN PA + F L + P +G+ SL+GT RSL+ A +S ++TRQ+ L Sbjct: 26 NNRPAASNF-LRGLSP--------KGSNTSLNGTRTPERSLMNRSATSSSTITRQK--LN 74 Query: 137 LQEIKPRNSQIVEES 93 L ++ PR V S Sbjct: 75 LSQVDPRTFADVHSS 89 >Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein. Length = 3347 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 3118 QIVFGHFGVVTCMARSECNITS 3139 >Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein. Length = 3554 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 3325 QIVFGHFGVVTCMARSECNITS 3346 >AY051596-1|AAK93020.1| 969|Drosophila melanogaster GH23814p protein. Length = 969 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 740 QIVFGHFGVVTCMARSECNITS 761 >AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB, isoform B protein. Length = 3522 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 3293 QIVFGHFGVVTCMARSECNITS 3314 >AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA, isoform A protein. Length = 3584 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 3355 QIVFGHFGVVTCMARSECNITS 3376 >AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC, isoform C protein. Length = 3719 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 390 QVLLGHFGIVPCHIP*PCNVRS 325 Q++ GHFG+V C CN+ S Sbjct: 3490 QIVFGHFGVVTCMARSECNITS 3511 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,105,564 Number of Sequences: 53049 Number of extensions: 499545 Number of successful extensions: 1069 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2213979693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -