BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10j06f (599 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27020.1 68418.m03223 hypothetical protein 28 4.1 At3g09560.2 68416.m01136 lipin family protein contains Pfam prof... 28 5.4 At3g09560.1 68416.m01135 lipin family protein contains Pfam prof... 28 5.4 At2g03140.1 68415.m00267 CAAX amino terminal protease family pro... 27 7.2 At5g48770.1 68418.m06035 disease resistance protein (TIR-NBS-LRR... 27 9.5 At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa... 27 9.5 >At5g27020.1 68418.m03223 hypothetical protein Length = 164 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -1 Query: 260 KLLLGKASYITRLGNMTWHDTKVSKKDLGMDKDFPMRSFVKKLKDMSGMVISV 102 K+ L K S ITR K KK+ M +DF R V ++K M+ ++ V Sbjct: 7 KIKLPKPSEITRRHKKEADMGKKIKKEENMKRDFIRRRMVFRVKKMTSVISGV 59 >At3g09560.2 68416.m01136 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 904 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 219 EYDMARYQSVQ-EGLGDGQGFSDEVIC*KIKGYV 121 EY AR+ ++ E GD QG EV+ I G++ Sbjct: 166 EYGSARFDNLNVESYGDSQGSDSEVVLVSIDGHI 199 >At3g09560.1 68416.m01135 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 904 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -3 Query: 219 EYDMARYQSVQ-EGLGDGQGFSDEVIC*KIKGYV 121 EY AR+ ++ E GD QG EV+ I G++ Sbjct: 166 EYGSARFDNLNVESYGDSQGSDSEVVLVSIDGHI 199 >At2g03140.1 68415.m00267 CAAX amino terminal protease family protein very low similarity to SP|Q40863 Late embryogenesis abundant protein EMB8 from Picea glauca; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 1805 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 188 WTLWYRAMSYSLTV*CTKLSLTTICLPVIYSSWKQFNPSPAVRLVSVELLYL 343 W L RA+ + V + LP + +W NPS L SV LY+ Sbjct: 1518 WPLLKRAVGFIGMVLVLWSPVVIPLLPTLLQNWSTSNPSRVAELASVVGLYV 1569 >At5g48770.1 68418.m06035 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1190 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 507 Y*KNSISLGLFRFFDDLRIPRLNLLESQMESLP 409 Y K+S S + F D L + LNL+ +ES+P Sbjct: 787 YRKDSASFQCYSFSDFLWLTELNLINLNIESIP 819 >At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 525 Score = 27.1 bits (57), Expect = 9.5 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 10/91 (10%) Frame = -3 Query: 498 NSISLGLFRFFDDLRIPRLNLLESQMESLPR--ERPAVISHMCDQ*PELIGSAQRYSSST 325 N S G+FRF+D R RL++ E L ++ +S + E + + + S Sbjct: 400 NLFSSGMFRFYDQHRDMRLDIDNMSYEELLALGDKMGTVSTALSE--EALSRSLKQSIYQ 457 Query: 324 ETNRTAG------EGLNC--FQEEYITGRQI 256 ET+ T + + C QEEY+ G ++ Sbjct: 458 ETDETGSISLYKDDDIKCSICQEEYVDGDEL 488 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,256,387 Number of Sequences: 28952 Number of extensions: 255703 Number of successful extensions: 624 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -