BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i23f (642 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 24 4.7 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 6.2 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 6.2 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 6.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.2 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.8 bits (49), Expect = 4.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 314 DCSPSNFDKTFDVNVKAVLNISQVVARKMIENKTHGAIVNISSQASKA 457 D +NFDK D+N + ++ Q + E T A V A+KA Sbjct: 352 DSGVANFDKISDLNAIYISSVIQQTKIVVNEEGTMTAAVTTGVFANKA 399 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 526 FRTRTIWNQSKCYQSYCDND 585 +RT IWNQ+ + + ++D Sbjct: 100 YRTLAIWNQTNTHPLFAESD 119 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 526 FRTRTIWNQSKCYQSYCDND 585 +RT IWNQ+ + + ++D Sbjct: 100 YRTLAIWNQTNTHPLFAESD 119 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 344 FDVNVKAVLNISQVVARKMIENKTHGAIVNISSQASKAAL 463 FD+ ++N+SQ RK + GA+ + SK L Sbjct: 268 FDLLFDRIVNVSQANMRKFNSWQMMGALCRVHRPMSKVLL 307 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 18 IQYN*KWKYLLKAKEFSLPVPGKVSA 95 I+Y K YLL K F L + G VSA Sbjct: 2286 IEYAVKQFYLLNRKPFILQMFGSVSA 2311 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,223 Number of Sequences: 2352 Number of extensions: 11809 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -