BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i21r (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 7.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.4 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 9.4 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 23 9.4 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 23 9.4 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.4 bits (48), Expect = 7.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 644 CYDIGEYVRHYPRGKHIIEQLGGKQRVMYLLSHD 543 C DI + H GKH+ +GG +R +L +H+ Sbjct: 247 CQDIASQLIHGEVGKHMQVIMGGGRR-EFLPTHE 279 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 545 DDPNVRYEALLAVQKL 498 DDPN+RY + A +++ Sbjct: 2011 DDPNLRYRSAFATRRI 2026 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -2 Query: 602 KHIIEQLGGKQRVMYLLSHDDPNVRYEALLAVQKL 498 KH QL G++ V +L+ D + Y+A++ ++ L Sbjct: 322 KHPEVQLEGRECVRDVLAKHDNKLSYDAVMEMEYL 356 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 471 AEIFPVVNHKFLHGEQGFVTYI 536 A+ + NH+F HG +G V ++ Sbjct: 135 ADAMTLGNHEFDHGVEGLVPFL 156 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 471 AEIFPVVNHKFLHGEQGFVTYI 536 A+ + NH+F HG +G V ++ Sbjct: 135 ADAMTLGNHEFDHGVEGLVPFL 156 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,853 Number of Sequences: 2352 Number of extensions: 13561 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -