BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i18r (567 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57150.3 68418.m08532 basic helix-loop-helix (bHLH) family pr... 31 0.71 At5g57150.2 68418.m08533 basic helix-loop-helix (bHLH) family pr... 31 0.71 At5g57150.1 68418.m08531 basic helix-loop-helix (bHLH) family pr... 31 0.71 At3g43230.1 68416.m04563 zinc finger (FYVE type) family protein ... 28 3.8 At2g34230.1 68415.m04188 hypothetical protein contains Pfam prof... 27 8.7 >At5g57150.3 68418.m08532 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 219 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/63 (22%), Positives = 28/63 (44%) Frame = +1 Query: 346 RELVVAARLTTKLRKSLSLEVILPILKALDLSVDLGSATSLVDTATIAVNTNNRANFILQ 525 REL + + K ++++P+ +D GS+TSL++ + V ++ Sbjct: 112 RELESTPKSSLSFSKDFDRDLLVPVTSKKMKQLDSGSSTSLIEVLELKVTFMGERTMVVS 171 Query: 526 ETC 534 TC Sbjct: 172 VTC 174 >At5g57150.2 68418.m08533 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 226 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/63 (22%), Positives = 28/63 (44%) Frame = +1 Query: 346 RELVVAARLTTKLRKSLSLEVILPILKALDLSVDLGSATSLVDTATIAVNTNNRANFILQ 525 REL + + K ++++P+ +D GS+TSL++ + V ++ Sbjct: 112 RELESTPKSSLSFSKDFDRDLLVPVTSKKMKQLDSGSSTSLIEVLELKVTFMGERTMVVS 171 Query: 526 ETC 534 TC Sbjct: 172 VTC 174 >At5g57150.1 68418.m08531 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 247 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/63 (22%), Positives = 28/63 (44%) Frame = +1 Query: 346 RELVVAARLTTKLRKSLSLEVILPILKALDLSVDLGSATSLVDTATIAVNTNNRANFILQ 525 REL + + K ++++P+ +D GS+TSL++ + V ++ Sbjct: 111 RELESTPKSSLSFSKDFDRDLLVPVTSKKMKQLDSGSSTSLIEVLELKVTFMGERTMVVS 170 Query: 526 ETC 534 TC Sbjct: 171 VTC 173 >At3g43230.1 68416.m04563 zinc finger (FYVE type) family protein contains Pfam domain PF01363: FYVE zinc finger Length = 485 Score = 28.3 bits (60), Expect = 3.8 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = -2 Query: 539 PVQVSCKMKFALLFVLTAIVAVSTNEVADP--RSTDRSNALSIGSITSSDRLLRSFVVSR 366 P+Q + K + L VLT ++A+ T +P + SN +GS T+ D + S V Sbjct: 86 PIQGNEKPEVNLKNVLTGLIAIVTGRNKNPLDQKNPSSNVSFLGSGTNGDTFVHSSVYIP 145 Query: 365 AATTNSRAVNVRYT 324 +A + Y+ Sbjct: 146 SAPPLLEPSGINYS 159 >At2g34230.1 68415.m04188 hypothetical protein contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 716 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 184 LQYKFGDAKMHILDVYMQRHE 122 + Y F D KMHILD ++ ++E Sbjct: 256 VNYCFTDCKMHILDKHVHKYE 276 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,325,001 Number of Sequences: 28952 Number of extensions: 184553 Number of successful extensions: 454 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -