BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i17r (427 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY481573-1|AAS47698.1| 5202|Homo sapiens Usher syndrome 2A isofo... 29 6.6 AL513305-1|CAH73621.1| 5202|Homo sapiens Usher syndrome 2A (auto... 29 6.6 AL445650-4|CAH70621.1| 5202|Homo sapiens Usher syndrome 2A (auto... 29 6.6 AL358858-2|CAH71588.1| 5202|Homo sapiens Usher syndrome 2A (auto... 29 6.6 AL358452-1|CAI19189.1| 5202|Homo sapiens Usher syndrome 2A (auto... 29 6.6 AL139259-1|CAI23041.1| 5202|Homo sapiens Usher syndrome 2A (auto... 29 6.6 >AY481573-1|AAS47698.1| 5202|Homo sapiens Usher syndrome 2A isoform B protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 >AL513305-1|CAH73621.1| 5202|Homo sapiens Usher syndrome 2A (autosomal recessive, mild) protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 >AL445650-4|CAH70621.1| 5202|Homo sapiens Usher syndrome 2A (autosomal recessive, mild) protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 >AL358858-2|CAH71588.1| 5202|Homo sapiens Usher syndrome 2A (autosomal recessive, mild) protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 >AL358452-1|CAI19189.1| 5202|Homo sapiens Usher syndrome 2A (autosomal recessive, mild) protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 >AL139259-1|CAI23041.1| 5202|Homo sapiens Usher syndrome 2A (autosomal recessive, mild) protein. Length = 5202 Score = 29.1 bits (62), Expect = 6.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 127 NKLVRLFTVKYSNCVTFMDRNLCNAVSKT*PASEAFFQGFVLCFKNSRLISARLEAWVLI 306 N + + V+Y N + + LC VS P S+ F V C S AW + Sbjct: 4383 NGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNF-SLVACTNGGCTASVSKSAWTME 4441 Query: 307 RLSSASDKP 333 L D P Sbjct: 4442 ALPENMDSP 4450 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,758,931 Number of Sequences: 237096 Number of extensions: 1213330 Number of successful extensions: 2297 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2297 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3316445452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -