BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i17f (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 3.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 3.1 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 7.0 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 7.0 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 7.0 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 7.0 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 9.3 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 280 TVKYSNCVTFMDRN 239 T+ YSN VTF RN Sbjct: 300 TIMYSNGVTFPQRN 313 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 280 TVKYSNCVTFMDRN 239 T+ YSN VTF RN Sbjct: 300 TIMYSNGVTFPQRN 313 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = -3 Query: 380 LLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVY 279 ++ +L + + K+ YNNN + L Y Sbjct: 81 IISSLSNRTIHNNNNYKYNYNNNNYNNNCKKLYY 114 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = -3 Query: 380 LLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVY 279 ++ +L + + K+ YNNN + L Y Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYY 114 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = -3 Query: 380 LLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVY 279 ++ +L + + K+ YNNN + L Y Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYY 114 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = -3 Query: 380 LLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVY 279 ++ +L + + K+ YNNN + L Y Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYY 114 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 7.0 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 299 VWIFCYCC 322 VWI CY C Sbjct: 183 VWILCYFC 190 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 7.0 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 299 VWIFCYCC 322 VWI CY C Sbjct: 216 VWIMCYFC 223 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 7.0 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 299 VWIFCYCC 322 VWI CY C Sbjct: 269 VWIMCYFC 276 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -3 Query: 356 VPYQGTKCKHGYNNNKKSKQTSSLVYGK 273 +P G CK GY + + ++ + GK Sbjct: 242 LPSGGCHCKPGYQADVEKQECTECPIGK 269 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.6 bits (41), Expect = 9.3 Identities = 9/44 (20%), Positives = 19/44 (43%) Frame = -3 Query: 380 LLFTLRSLVPYQGTKCKHGYNNNKKSKQTSSLVYGKIFKLCYFH 249 ++ +L + + K+ YNNN + + Y K Y++ Sbjct: 314 IISSLSNKTIHNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYN 357 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,891 Number of Sequences: 438 Number of extensions: 2840 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -