BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i16r (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30845.1 68414.m03772 expressed protein 30 1.6 At4g22180.1 68417.m03206 F-box family protein contains F-box dom... 27 8.5 >At1g30845.1 68414.m03772 expressed protein Length = 124 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 505 VFDYGKYIICNIILWYCILTVV*KTLSNL 419 V YG +ICN+++W C + + + LS+L Sbjct: 35 VIKYGLVVICNVVMWACYVNSL-RALSSL 62 >At4g22180.1 68417.m03206 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 64 ISVDKLTNICN-ITYANLSAAGGMCSSAHPLRAQ*ILPQVHNLNLAQRYDYRSS 222 + +D LT + ++YAN A +CSS H Q + Q+ L L YD +S Sbjct: 24 LPLDLLTAVFERLSYANFQRAKSVCSSWHSGSRQSVPIQIPWLILFPEYDNNNS 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,885,868 Number of Sequences: 28952 Number of extensions: 213017 Number of successful extensions: 666 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -