BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i14f (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18760.1 68415.m02184 SNF2 domain-containing protein / helica... 33 0.16 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 33 0.16 At4g11940.1 68417.m01897 hypothetical protein predicted proteins... 28 4.5 At1g67140.1 68414.m07638 expressed protein 28 4.5 At5g37080.1 68418.m04451 hypothetical protein includes At5g37080... 27 5.9 At1g55290.1 68414.m06316 oxidoreductase, 2OG-Fe(II) oxygenase fa... 27 7.8 >At2g18760.1 68415.m02184 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|Q03468 Excision repair protein ERCC-6 (Cockayne syndrome protein CSB) {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1187 Score = 32.7 bits (71), Expect = 0.16 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 319 SETEKSGDHSPQSKNDGTWDSKLSPVL 399 SE+ DH P+SKN WDS L+ VL Sbjct: 487 SESSVDSDHEPKSKNTKKWDSLLNRVL 513 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 32.7 bits (71), Expect = 0.16 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 398 KTGESFESHVPSFFDWGEWS-PLFSVSEIFTKRSLNFFSTLSSEMDLSTSSIVVPVGRT 225 +TG +F +F +G+ S P F + IF K S F + SS L+TSS P G+T Sbjct: 550 QTGSAFGQTGSAFGQFGQSSAPAFGQNSIFNKPSTGFGNMFSSSSTLTTSS-SSPFGQT 607 >At4g11940.1 68417.m01897 hypothetical protein predicted proteins Arabidopsis thaliana Length = 264 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 91 TVRELSDAINDNTVNATPKKVLEGILNDYMDLQYAKETPYTTG 219 T++E+ D + VN P +G +N+YMD+ + ++ Y G Sbjct: 130 TIKEMYDYATSDEVNLEP----QGNVNEYMDVDSSSQSGYGLG 168 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 27.9 bits (59), Expect = 4.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +1 Query: 343 HSPQSKNDGTWDSKLSPVLVLVR 411 H+ S +DG WD+ LSP+ + ++ Sbjct: 1549 HNEISPDDGIWDNMLSPLFISIK 1571 >At5g37080.1 68418.m04451 hypothetical protein includes At5g37080, At5g37170, At2g05090 Length = 566 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 312 HKEIVELLLDAVVRDGLVYVINSRAGGKDLLACGVRRLLG 193 H VEL + ++ DGL I +DL+ G R+LG Sbjct: 253 HVPEVELFVKSLPSDGLALTIQDNYVNRDLIKVGQWRILG 292 >At1g55290.1 68414.m06316 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to GI:5924383 from [Daucus carota]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 361 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 407 TKTKTGESFESHVPSFFDWGEWSPLFSVSE 318 T + G SF H +W ++ LF VSE Sbjct: 130 TNVRFGTSFSPHAEKALEWKDYLSLFFVSE 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,991,738 Number of Sequences: 28952 Number of extensions: 181092 Number of successful extensions: 567 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -