BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i13r (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 27 0.59 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 1.8 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 3.2 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 4.2 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 5.5 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 27.1 bits (57), Expect = 0.59 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 713 DQPYC*RRILTSGDYNVIVVDWSSFSLSTYSTAVM 609 D+ Y I+ SGD+N +W S S + AV+ Sbjct: 107 DEVYDVNPIIISGDFNAWATEWGSKSTNARGNAVL 141 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 692 RILTSGDYNVIVVDWSS 642 R+L +GD+N + +DW S Sbjct: 116 RVLLAGDFNAMHLDWGS 132 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 429 KQRTTTGNKRCSIR*SYSHRRIWCQQKRLGRCY 331 K R+ T RC +R + H+R W + CY Sbjct: 446 KNRSLTEMGRCMLRDAGMHKRFWAEAVNTA-CY 477 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -1 Query: 572 LKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARI 462 L+ +KL + K H ++ + + R EGK+ R+ Sbjct: 972 LEEMKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRL 1008 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 695 RRILTSGDYNVIVVDWSSFSLSTYSTAVM 609 R ++ +GD+N V+W S ++ AV+ Sbjct: 111 RPLVIAGDFNAWAVEWGSKRTNSRGDAVL 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,974 Number of Sequences: 2352 Number of extensions: 15624 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -