BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i09r (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42530| Best HMM Match : ELFV_dehydrog_N (HMM E-Value=0) 219 2e-57 SB_30426| Best HMM Match : CXC (HMM E-Value=2.8) 31 0.76 SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) 31 1.3 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) 29 5.4 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 28 7.1 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_29837| Best HMM Match : MobC (HMM E-Value=6.8) 28 9.4 SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 28 9.4 SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_42530| Best HMM Match : ELFV_dehydrog_N (HMM E-Value=0) Length = 520 Score = 219 bits (536), Expect = 2e-57 Identities = 103/145 (71%), Positives = 124/145 (85%) Frame = -2 Query: 756 ADXILIDRNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQE 577 AD ILI LVIPDLY+NAGGVTVS+FEWLKN+NHVS+GRLT+KYE+ESNYHLLESVQ+ Sbjct: 376 ADQILIANKQLVIPDLYLNAGGVTVSYFEWLKNINHVSFGRLTWKYEKESNYHLLESVQK 435 Query: 576 SLERRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMRFNLGL 397 SLER FG IP+TPSE+FQ++ISGASE+DIVHSGL++TMERSA+ IM+ A +NLGL Sbjct: 436 SLERHFGG-SSHIPITPSEAFQEQISGASERDIVHSGLEFTMERSAKQIMRCAEEYNLGL 494 Query: 396 DLRTAAYANSIEKIFTTYADAGLAF 322 D+RTAAY +IEK++ TYA AG F Sbjct: 495 DIRTAAYIVAIEKVYNTYAVAGFTF 519 >SB_30426| Best HMM Match : CXC (HMM E-Value=2.8) Length = 410 Score = 31.5 bits (68), Expect = 0.76 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 111 FTYKRHCNHSIFLCVEIMAFYLNLSETLLN 22 FT H S F+C++I+ FY ++S+ LLN Sbjct: 70 FTSTEHKTASNFICLDIVEFYPSISQELLN 99 >SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) Length = 262 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 383 PRMRTPSKRYSPRMPMPV*LSNNSLTEYQF*SIVCIVFSEE 261 P+ RTP KR P P LSN T+ + +++ + EE Sbjct: 103 PKKRTPEKRIQKSDPSPGILSNEDFTDLDYNTMMASLIGEE 143 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 406 PRFRS--EDSRVCELHRKDIHHVCRCRSSFLIIHLLN 302 P FR+ E++ VC++H ++ C C +F IH N Sbjct: 2050 PCFRNPCENNGVCKIHPVHFNYTCNCTDTFTGIHCEN 2086 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 111 FTYKRHCNHSIFLCVEIMAFYLNLSETLLN 22 FT ++ S F+C +I+ FY ++S+ LLN Sbjct: 1131 FTSTKNKTASNFICFDIVEFYPSISQELLN 1160 >SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3) Length = 466 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 111 FTYKRHCNHSIFLCVEIMAFYLNLSETLLN 22 FT ++ S F+C +I+ FY ++S+ LLN Sbjct: 237 FTSTKNKTASNFICFDIVEFYPSISQELLN 266 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 418 GCLHDGPSGSLHGVVESGVHDVLLGGAGDSLLEGL*GSDGDAASHATEPPLERLLDRFQQ 597 GC + +G +HG + D G GD ++ G D D ++ +PPL +L ++ Q Sbjct: 168 GCDDNDDNGEIHGDTQKYTDDDSGGDDGDGGVDDGNGGDYDDDNN-DDPPLSSVLRQYYQ 226 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 418 GCLHDGPSGSLHGVVESGVHDVLLGGAGDSLLEGL*GSDGDAASHATEPPLERLLDRFQQ 597 GC + +G +HG + D G GD ++ G D D ++ +PPL +L ++ Q Sbjct: 183 GCDDNDDNGEIHGDTQKYTDDDSGGDDGDGGVDDGNGGDYDDDNN-DDPPLSSVLRQYYQ 241 >SB_29837| Best HMM Match : MobC (HMM E-Value=6.8) Length = 327 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -2 Query: 84 SIFLCVEIMAFYLNLSETLLN 22 S F+C +++ FY ++SE LLN Sbjct: 127 SAFICFDVVEFYPSISEDLLN 147 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 496 RLREGHRALRTRLHHGEIR*GHHEDSHEVQPRFRSEDSRVCELHRKD 356 R R+G + R + H R HE+ + + RFR D + +L R+D Sbjct: 330 RHRDGRESWREKPKH---RRRSHEEREQRRDRFRDRDEKGSDLERRD 373 >SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1482 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 658 VLEPLEE*DGDTTSVDVEVGDHENVAIDEDLV 753 +L+ +++ DGDT DV+V D + + D D+V Sbjct: 848 LLDDVDDVDGDTLLDDVDVVDEDTLLADVDVV 879 >SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1270 Score = 27.9 bits (59), Expect = 9.4 Identities = 24/70 (34%), Positives = 29/70 (41%), Gaps = 2/70 (2%) Frame = -1 Query: 535 RHSLRVLPEENLRRLREGHRALRTRLH-HGEIR*GHHEDSHEV-QPRFRSEDSRVCELHR 362 R LR + + RL + H A R RLH E D HEV + R R +C Sbjct: 831 RKRLRDRHKASRIRLHDKHEASRNRLHDRHEASRNRLRDRHEVSRKRLRDRHKALCN-RL 889 Query: 361 KDIHHVCRCR 332 D H V R R Sbjct: 890 CDRHEVSRKR 899 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,270,273 Number of Sequences: 59808 Number of extensions: 473755 Number of successful extensions: 1418 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1412 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -