BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i09r (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 3.3 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 4.4 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 397 RSEDSRVCELHRKDIHHVCRCR 332 RS D R+ HRK + HV CR Sbjct: 83 RSLDGRLQVSHRKGLPHVIYCR 104 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -2 Query: 618 ERESNYHLLESVQESLERRFGRVGGRIPVTPSESFQK 508 +RE+N+ LLE +S ++ V ++ ++S K Sbjct: 745 DREANFRLLEDAYQSAKKTLANVEKKLAEVKAKSSDK 781 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,973 Number of Sequences: 2352 Number of extensions: 16539 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -