BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i08r (472 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC830.10 |||nucleoside triphosphatase |Schizosaccharomyces pom... 25 4.4 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 5.8 SPBC1778.01c |zuo1|mpp11, SPBC30D10.01|zuotin |Schizosaccharomyc... 25 7.7 SPAC23H3.09c |gly1||threonine aldolase |Schizosaccharomyces pomb... 25 7.7 SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 25 7.7 SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pomb... 25 7.7 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 25 7.7 >SPCC830.10 |||nucleoside triphosphatase |Schizosaccharomyces pombe|chr 3|||Manual Length = 188 Score = 25.4 bits (53), Expect = 4.4 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +1 Query: 274 WIFKSFNS*GLFKLIQLWDTFDSKLGVVRHCVRGP 378 W S GL++++ +DT +++ G +GP Sbjct: 85 WFLNSVGPDGLYRMVSAFDTKEAQAGCTFGYTKGP 119 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.0 bits (52), Expect = 5.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 339 VKGIPQLDELEKALAVKGLKDPWIRNEAWRYHP 241 +KGI LDEL+KA+ +K + + +R P Sbjct: 243 IKGILTLDELQKAIKLKQTELDKLERRLYRPSP 275 >SPBC1778.01c |zuo1|mpp11, SPBC30D10.01|zuotin |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 24.6 bits (51), Expect = 7.7 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 251 LQASFLIHGSLSPLTAKA 304 ++ASF+ HG +SPL +A Sbjct: 18 IEASFVPHGKISPLIKRA 35 >SPAC23H3.09c |gly1||threonine aldolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 376 Score = 24.6 bits (51), Expect = 7.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 447 KSSSLIIVCEVNGNLLRMGGHGHGPPYTV 361 K ++L + GN L + H H PP+++ Sbjct: 76 KEAALFVTSGTQGNQLCIRSHLHQPPHSI 104 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 24.6 bits (51), Expect = 7.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 453 KRKSSSLIIVCEVNGNLLRMGGHGHGPPYTVPHYS 349 +R SS + ++N RMGG G PP++ +S Sbjct: 1276 QRPSSGRMHGRDMNRGDSRMGGRGSNPPFSSSDWS 1310 >SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pombe|chr 2|||Manual Length = 1136 Score = 24.6 bits (51), Expect = 7.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 256 SLISDPWIFKSFNS*GLFKLIQLWDTFDSKL 348 + I DP++ +SF+ L KLI +T D L Sbjct: 540 AFIRDPYLIESFDEEPLTKLISSLETDDPSL 570 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 24.6 bits (51), Expect = 7.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 121 PMFTPSHKFIQSHCDYCESQSNGKSSKEEFSGSLPASAKSRVISPSLISDP 273 P F P + H +Y ++QS ++ SLP + ++ P+L+S+P Sbjct: 500 PQFPPFE--LPPH-NYSQAQSPNLATPSPSFSSLPDVSLPPIVKPNLMSEP 547 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,058,752 Number of Sequences: 5004 Number of extensions: 43198 Number of successful extensions: 115 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -