BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i08f (519 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70034-4|CAA93855.1| 103|Caenorhabditis elegans Hypothetical pr... 61 4e-10 Z68507-3|CAA92824.2| 1134|Caenorhabditis elegans Hypothetical pr... 27 8.0 Z11505-3|CAA77584.2| 468|Caenorhabditis elegans Hypothetical pr... 27 8.0 >Z70034-4|CAA93855.1| 103|Caenorhabditis elegans Hypothetical protein C18E9.4 protein. Length = 103 Score = 61.3 bits (142), Expect = 4e-10 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 4/88 (4%) Frame = +2 Query: 77 MGGHGHGPPYTVPHYSQFT-VKGIPQLDELEKALAVKGLKDPWIRNEAWRY---HPGFGT 244 MGG GH P+ +P+YS ++ + PQL + EK LA GLKDPWIRN + Y +P Sbjct: 1 MGG-GHHEPFKIPNYSIYSNFRDFPQLAQHEKRLAQIGLKDPWIRNYVYLYDRKYPHVVG 59 Query: 245 RWQRARKFFFRGFPIGLGLTVITVALDK 328 +W +K G+ G+ T + +++ Sbjct: 60 QWAHFKKLILPGWKAGVAFTAALIFVEE 87 >Z68507-3|CAA92824.2| 1134|Caenorhabditis elegans Hypothetical protein M18.5 protein. Length = 1134 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 186 DLKIHGSEMRLGDITLDLALAGREPENSSLEDFPLDWDSQ 305 DLK+ E+ + D+ ++L + E+ DW+SQ Sbjct: 908 DLKVMNEEVAVADVMRSVSLLSYRMLEGNFEEVAKDWNSQ 947 >Z11505-3|CAA77584.2| 468|Caenorhabditis elegans Hypothetical protein F59B2.5 protein. Length = 468 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 336 EGVNMGMVTGTRESIDFVVNCLHHCS*NKIELL 434 +GV + G +E ID + NC+ + NK E L Sbjct: 137 QGVGPALDHGKKEKIDLLTNCIGWATSNKREFL 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,110,722 Number of Sequences: 27780 Number of extensions: 252438 Number of successful extensions: 673 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1007108110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -