BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i06r (497 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31270| Best HMM Match : rve (HMM E-Value=0.0043) 29 2.1 SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_33462| Best HMM Match : DUF400 (HMM E-Value=6.7) 28 4.9 SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) 27 6.5 SB_48572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 27 8.6 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) 27 8.6 >SB_31270| Best HMM Match : rve (HMM E-Value=0.0043) Length = 479 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 211 SRARTALTRLPAGAVYLTLTACELAVAARVTTKLRNSLSFGAILPIA 351 S R LTRL ++ L +T CE + R N ++ G +LPIA Sbjct: 260 SNIRGVLTRLQVHSLCLQITKCEFVL--REVEYKGNKITQGGVLPIA 304 >SB_41802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 193 NWDTPTSRARTALTRLPAGAVYLTLTACELAVAARVTT 306 +WD S A L P G+ + L AC+L R TT Sbjct: 35 SWDALVSLAEDDLKGCPRGSSRVDLQACKLGTGRRFTT 72 >SB_33462| Best HMM Match : DUF400 (HMM E-Value=6.7) Length = 212 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 152 KLNRPRPRQGGQSXXXXXXXXXXXXXXXVYRRAPC 256 KL R RPR+ GQS VYR PC Sbjct: 31 KLRRRRPRRPGQSATEKEKPAPVLGPSDVYRENPC 65 >SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2418 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 165 PAPDKADSRELGHPYFPGS 221 P PD AD +E PYFP S Sbjct: 353 PLPDSADPKENTKPYFPQS 371 >SB_48572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 312 ELRCDSCCDSQLAGCQREVHGA 247 E+ CDSC DSQ + EV+G+ Sbjct: 122 EMICDSCMDSQQVITKEEVNGS 143 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 165 PAPDKADSRELGHPYFPGSDGPDASTGGRR 254 P PD + + G P FPG G +A T G + Sbjct: 373 PVPDHGEKGQSGEPGFPGEIG-EAGTQGEK 401 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 27.1 bits (57), Expect = 8.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 150 RHSPVQKLSTKRISLQCTDL 91 RH+PV K++ R+S C DL Sbjct: 191 RHNPVLKIAGPRVSADCRDL 210 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/56 (30%), Positives = 22/56 (39%) Frame = +3 Query: 162 DPAPDKADSRELGHPYFPGSDGPDASTGGRRVPHVDSLRAGCRSTSHNEAP*QSII 329 D A + H + PGS S G RR P +G TS N + Q +I Sbjct: 830 DSASRHGNQAPEAHHHEPGSYKSPHSEGSRRTPSGVPYSSGSEGTSSNPSDAQDVI 885 >SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) Length = 635 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 297 SCCDSQLAGCQREVHGARR*TRQGRPSPGSRGV 199 SC +L GC R+ G+ R +PS SR V Sbjct: 435 SCATGRLPGCTRKPSGSSRRVFSRKPSGSSRRV 467 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,621,662 Number of Sequences: 59808 Number of extensions: 250535 Number of successful extensions: 592 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -