BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10i06r (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 3.1 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 3.1 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.4 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 356 GLAIGSIAPNDRLL 315 GLA+G I NDR+L Sbjct: 250 GLALGPIRNNDRIL 263 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 188 TVRLVGGGVGSTFVTLQFRNSARRGYHFNVQI 93 +VRL+ G FVT+Q + ++ N+ I Sbjct: 301 SVRLISSGFFDNFVTVQIQPLKNELFNANIGI 332 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 17 LNLKPLSHKQMHMCFTGGQMRFSVPKSVH*SDILF 121 L+ KP Q+H CF + V + V+ D+++ Sbjct: 40 LSTKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMY 74 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 207 YFPGSDGPDASTGGRRVPH 263 YF S PD GG PH Sbjct: 4 YFANSYIPDLRNGGVEHPH 22 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,982 Number of Sequences: 438 Number of extensions: 2044 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -